Property Summary

NCBI Gene PubMed Count 7
PubMed Score 786.32
PubTator Score 52.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 4.4e-09
osteosarcoma 7933 1.9e-08
group 3 medulloblastoma 2254 1.2e-03
medulloblastoma, large-cell 6234 1.1e-02
Disease Target Count Z-score Confidence
Syringoma 10 4.187 2.1
Myopia 99 3.403 1.7
Astigmatism 27 3.377 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.754 1.9e-08
medulloblastoma, large-cell 1.100 1.1e-02
group 3 medulloblastoma 1.700 1.2e-03
ovarian cancer 1.200 4.4e-09

Synonym

Accession Q8N907
Symbols SP1
CER2
COCO
CRL2
CERL2
DANTE
GREM3
CKTSF1B3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
22901808 A gain-of-function cDNA screen reveals that Coco, a secreted antagonist of TGF-beta ligands, induces dormant breast cancer cells to undergo reactivation in the lung.

AA Sequence

MLLGQLSTLLCLLSGALPTGSGRPEPQSPRPQSWAAANQTWALGPGALPPLVPASALGSWKAFLGLQKAR      1 - 70
QLGMGRLQRGQDEVAAVTLPLNPQEVIQGMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPT     71 - 140
PLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA                         141 - 189
//

Text Mined References (8)

PMID Year Title
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
22901808 2012 The BMP inhibitor Coco reactivates breast cancer cells at lung metastatic sites.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466485 2004 The activity of the Nodal antagonist Cerl-2 in the mouse node is required for correct L/R body axis.
15254711 2004 Identification and characterization of human CKTSF1B2 and CKTSF1B3 genes in silico.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14525956 2004 Comparative genomic analysis of the eight-membered ring cystine knot-containing bone morphogenetic protein antagonists.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.