Property Summary

NCBI Gene PubMed Count 5
Grant Count 14
R01 Count 8
Funding $2,239,922.5
PubMed Score 100.97
PubTator Score 63.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.900 0.000

Gene RIF (3)

PMID Text
25048963 MCIDAS mutations result in a mucociliary clearance disorder with reduced generation of multiple motile cilia.MCIDAS regulates CCNO and FOXJ1 expression.
24064211 The properties of the Idas-Geminin complex suggest it as the functional form of Idas and provide a possible mechanism to modulate Geminin activity
21543332 Idas as a novel Geminin binding partner, implicated in cell cycle progression, and a putative regulator of proliferation-differentiation decisions during development.

AA Sequence

MQACGGGAAGRRAFDSICPNRMLALPGRALLCKPGKPERKFAPPRKFFPGCTGGSPVSVYEDPPDAEPTA      1 - 70
LPALTTIDLQDLADCSSLLGSDAPPGGDLAASQNHSHQTEADFNLQDFRDTVDDLISDSSSMMSPTLASG     71 - 140
DFPFSPCDISPFGPCLSPPLDPRALQSPPLRPPDVPPPEQYWKEVADQNQRALGDALVENNQLHVTLTQK    141 - 210
QEEIASLKERNVQLKELASRTRHLASVLDKLMITQSRDCGAAAEPFLLKAKAKRSLEELVSAAGQDCAEV    211 - 280
DAILREISERCDEALQSRDPKRPRLLPEPANTDTRPGNLHGAFRGLRTDCSRSALNLSHSELEEGGSFST    281 - 350
RIRSHSTIRTLAFPQGNAFTIRTANGGYKFRWVPS                                       351 - 385
//

Text Mined References (5)

PMID Year Title
25048963 2014 MCIDAS mutations result in a mucociliary clearance disorder with reduced generation of multiple motile cilia.
24064211 2013 The Geminin and Idas coiled coils preferentially form a heterodimer that inhibits Geminin function in DNA replication licensing.
22231168 2012 Multicilin promotes centriole assembly and ciliogenesis during multiciliate cell differentiation.
21543332 2011 Idas, a novel phylogenetically conserved geminin-related protein, binds to geminin and is required for cell cycle progression.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.