Property Summary

NCBI Gene PubMed Count 5
PubMed Score 109.53
PubTator Score 63.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 1.4e-17
Disease Target Count Z-score Confidence
Primary ciliary dyskinesia 76 0.0 4.0
Disease Target Count
Ciliary Dyskinesia, Primary, 1 27

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.900 1.4e-17

Gene RIF (3)

AA Sequence

MQACGGGAAGRRAFDSICPNRMLALPGRALLCKPGKPERKFAPPRKFFPGCTGGSPVSVYEDPPDAEPTA      1 - 70
LPALTTIDLQDLADCSSLLGSDAPPGGDLAASQNHSHQTEADFNLQDFRDTVDDLISDSSSMMSPTLASG     71 - 140
DFPFSPCDISPFGPCLSPPLDPRALQSPPLRPPDVPPPEQYWKEVADQNQRALGDALVENNQLHVTLTQK    141 - 210
QEEIASLKERNVQLKELASRTRHLASVLDKLMITQSRDCGAAAEPFLLKAKAKRSLEELVSAAGQDCAEV    211 - 280
DAILREISERCDEALQSRDPKRPRLLPEPANTDTRPGNLHGAFRGLRTDCSRSALNLSHSELEEGGSFST    281 - 350
RIRSHSTIRTLAFPQGNAFTIRTANGGYKFRWVPS                                       351 - 385
//

Text Mined References (5)

PMID Year Title