Property Summary

NCBI Gene PubMed Count 50
PubMed Score 96.54
PubTator Score 76.28

Knowledge Summary

Patent (30,755)

TINX Plot

  Disease (4)

Disease Target Count P-value
acute myeloid leukemia 785 6.1e-03
Disease Target Count Z-score Confidence
Asthma 349 5.212 2.6
Allergic rhinitis 92 4.001 2.0
Urticaria 53 3.247 1.6
Disease Target Count
Uveal melanoma 18

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia 2.500 6.1e-03

Gene RIF (38)

PMID Text
26433531 CysLT2 receptors were expressed in lung specimens isolated from asthma subjects. Activation of CysLT2 receptors may contribute to antigen-induced bronchoconstriction in certain asthma population.
25839425 Autocrine activity of cysteinyl leukotrienes in human vascular endothelial cells: Signaling through the CysLT receptor
25760841 CysLTR-1 and CysLTR-2 are highly expressed in the adenoid tissues from children with AH, suggesting that leukotrienes are involved in the pathogenesis of AH.
24285579 Suggest that endothelial and nonendothelial CysLT2R niches have separate roles in mediating inflammatory responses in ischemic/perfusion injury.
23829413 ATRA treatment induces CysLT(2)R mRNA and protein expression in colon cancer cell lines
23524649 CysLT2 receptor plays a primary role in the vascular responses in the upper respiratory tract.
22634478 increased expression in tonsillar tissues of Chinese children with sleep-disordered breathing
22194989 There is a protective role against tumor progression for CysLT(2)R and that it highlights new possibilities to regulate the CysLT(2)R.
21753081 The synthesis of cys-LTs from LTA(4) by endothelial cells is directly associated with the activation of the CysLT(2) receptor in a typical autocrine fashion.
21352274 Cysteinyl leukotriene receptor 2 gene polymorphism -1220 A/C is not associated with atopic dermatitis or psoriasis vulgaris in Japanese patients.
21203429 upon ligand activation, CysLT(1)R is tyrosine-phosphorylated and released from heterodimers with CysLT(2)R and, subsequently, internalizes from the plasma membrane to the nuclear membrane in a clathrin-, arrestin-3-, and Rab-5-dependent manner
20966037 results indicate that the M201V polymorphism drastically affects CysLT(2) responses to LTD(4) and less to LTC(4)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20433311 Data show functional expression of CysLT1 and 2 receptors on human platelets and demonstrate that CysLTs induced the release of significant amounts of RANTES, which suggests a novel role for human platelets in CysLT-mediated allergic inflammation.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19840403 The sequence variants of CysLTR2 may affect its transcription and the stability of its mRNA, resulting in altered expression of CysLTR2 protein, which in turn causes some asthmatics to be susceptible to aspirin hypersensitivity
19450127 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19264973 Observational study of gene-disease association. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19131661 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18946233 increase in urinary levels is associated with anaphylaxies and eosinophilic pneumonia
18779380 Our results reveal that CysLT(2)R can mediate inflammatory reactions in a vascular bed-specific manner by altering transendothelial vesicle transport-based vascular permeability.
18366797 Observational study of gene-disease association. (HuGE Navigator)
18048362 the potential implication of CysLT2 in the inflammatory response through the modulation of chemokine gene transcription.
17991613 Since prostacyclin is a major blood vessel-protective and anti-thrombotic eicosanoid, the EC cysLT(2)-R may limit its otherwise pro-inflammatory actions through a protective Ca(2+)/calcineurin/NFAT-dependent COX-2 feedback loop
17941281 CysLT1R and CysLT2R expression in monocytes can be regulated by CysLT itself and T(H)2 cytokines at the transcriptional level.
17460547 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17460547 CYSLTR2 and ALOX5 polymorphisms may predispose a minority of individuals to excessive cysteinyl-leukotriene concentrations, yielding a distinct asthma phenotype most likely to respond to leukotriene modifier pharmacotherapy.
16771777 Observational study of gene-disease association. (HuGE Navigator)
16606835 Because LTD4 and thrombin are likely to be formed concomitantly in vivo, cysLT2-R and PAR-1 may cooperate to augment vascular injury.
15970796 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15696087 CysLT 1 expression predominates on inflammatory leukocytes in aspirin-sensitive rhinosinusitis. Effects of cysteinyl leukotrienes on glands and epithelium may be mediated predominantly through cysLT 2. Potentially important therapeutic implications.
15545522 Endothelial CysLT2R increases vascular permeability & recruits neutrophils via enhanced P-selectin expression. It may participate in hypotensive anaphylaxis. CysLT2R-dependent NO formation interacts with superoxide to form peroxynitrite.
15475736 601A>G coding polymorphism in the CYSLT2 receptor alters the potency of LTD4
15454733 identified three novel exons in the 5' untranslated region of CYSLTR2 and eight novel polymorphisms; the -1220A > C polymorphism is associated with the development of asthma
14515063 Mutations in cysteinyl leukotriene 2 receptor is associated with atopy
13679572 mast cells express the type 2 receptor for cysLTs (CysLT2R) as well, and that the amount of surface CysLT2R protein increases in response to priming with IL-4
12816881 Ca2+ fluxes elicited by CysLT in these vascular endothelial cells emanate from perturbation of the CysLT2R, rather than the expected CysLT1R.

AA Sequence

MERKFMSLQPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFFWGVLGNGLSIYVFLQPYKKS      1 - 70
TSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYVNMYSSIYFLTVLSVVRFLAM     71 - 140
VHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQNGSVTSCLELNLYKIAKLQTMNYIALVVGC    141 - 210
LLPFFTLSICYLLIIRVLLKVEVPESGLRVSHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCK    211 - 280
DRLHKALVITLALAAANACFNPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV        281 - 346
//

Text Mined References (50)

PMID Year Title
26433531 2015 Expression of CysLT2 receptors in asthma lung, and their possible role in bronchoconstriction.
25839425 2015 Autocrine activity of cysteinyl leukotrienes in human vascular endothelial cells: Signaling through the CysLT? receptor.
25760841 2015 [Expression of CysLTR-1 and CysLTR-2 in adenoid tissues from children with adenoid hypertrophy].
24792382 2014 Genome-wide association study identifies ALLC polymorphisms correlated with FEV? change by corticosteroid.
24285579 2014 Multiple-site activation of the cysteinyl leukotriene receptor 2 is required for exacerbation of ischemia/reperfusion injury.
23829413 2013 The cysteinyl leukotriene 2 receptor contributes to all-trans retinoic acid-induced differentiation of colon cancer cells.
23524649 2013 Localization and up-regulation of cysteinyl leukotriene-2 receptor in human allergic nasal mucosa.
22634478 2012 Increased cysteinyl leukotriene concentration and receptor expression in tonsillar tissues of Chinese children with sleep-disordered breathing.
22194989 2011 Regulation of cysteinyl leukotriene receptor 2 expression--a potential anti-tumor mechanism.
21753081 2011 Synthesis of cysteinyl leukotrienes in human endothelial cells: subcellular localization and autocrine signaling through the CysLT2 receptor.
21352274 2011 Cysteinyl leukotriene receptor 2 gene polymorphism -1220 A/C is not associated with atopic dermatitis or psoriasis vulgaris in Japanese patients.
21203429 2010 Ligand-induced tyrosine phosphorylation of cysteinyl leukotriene receptor 1 triggers internalization and signaling in intestinal epithelial cells.
20966037 2011 Differential signaling defects associated with the M201V polymorphism in the cysteinyl leukotriene type 2 receptor.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20433311 2010 Functional expression of cysteinyl leukotriene receptors on human platelets.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19840403 2009 Genetic effect of CysLTR2 polymorphisms on its mRNA synthesis and stabilization.
19450127 2009 Asthma pharmacogenetic study using finite mixture models to handle drug-response heterogeneity.
19264973 2009 Assessing the reproducibility of asthma candidate gene associations, using genome-wide data.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19131661 2009 Genetic variation in the leukotriene pathway and carotid intima-media thickness: a 2-stage replication study.
18946233 2008 Hyperleukotrieneuria in patients with allergic and inflammatory disease.
18779380 2008 Cysteinyl leukotriene 2 receptor-mediated vascular permeability via transendothelial vesicle transport.
18366797 2008 Influence of leukotriene gene polymorphisms on chronic rhinosinusitis.
18048362 2008 Signaling by the cysteinyl-leukotriene receptor 2. Involvement in chemokine gene transcription.
17991613 2007 5-Lipoxygenase/cyclooxygenase-2 cross-talk through cysteinyl leukotriene receptor 2 in endothelial cells.
17941281 2007 Agonist- and T(H)2 cytokine-induced up-regulation of cysteinyl leukotriene receptor messenger RNA in human monocytes.
17460547 2007 Pharmacogenetics of the 5-lipoxygenase biosynthetic pathway and variable clinical response to montelukast.
17404310 2007 IFN-gamma induces cysteinyl leukotriene receptor 2 expression and enhances the responsiveness of human endothelial cells to cysteinyl leukotrienes.
16771777 2006 Determination of structure and transcriptional regulation of CYSLTR1 and an association study with asthma and rhinitis.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16606835 2006 Cysteinyl leukotriene 2 receptor and protease-activated receptor 1 activate strongly correlated early genes in human endothelial cells.
15970796 2005 Association analysis of cysteinyl-leukotriene receptor 2 (CYSLTR2) polymorphisms with aspirin intolerance in asthmatics.
15696087 2005 Expression of the cysteinyl leukotriene receptors cysLT(1) and cysLT(2) in aspirin-sensitive and aspirin-tolerant chronic rhinosinusitis.
15545522 2004 Directed vascular expression of human cysteinyl leukotriene 2 receptor modulates endothelial permeability and systemic blood pressure.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15475736 2004 A coding polymorphism in the CYSLT2 receptor with reduced affinity to LTD4 is associated with asthma.
15454733 2004 Association between a polymorphism in cysteinyl leukotriene receptor 2 on chromosome 13q14 and atopic asthma.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14515063 2003 A cysteinyl leukotriene 2 receptor variant is associated with atopy in the population of Tristan da Cunha.
13679572 2003 Expression of the type 2 receptor for cysteinyl leukotrienes (CysLT2R) by human mast cells: Functional distinction from CysLT1R.
12816881 2003 Dominant expression of the CysLT2 receptor accounts for calcium signaling by cysteinyl leukotrienes in human umbilical vein endothelial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12100046 2002 Expression and localization of the cysteinyl leukotriene 1 receptor in human nasal mucosa.
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.
11696047 2001 Levels of cysteinyl leukotriene receptor mRNA in human peripheral leucocytes: significantly higher expression of cysteinyl leukotriene receptor 2 mRNA in eosinophils.
11093801 2000 Molecular cloning and characterization of a second human cysteinyl leukotriene receptor: discovery of a subtype selective agonist.
10913337 2000 The molecular characterization and tissue distribution of the human cysteinyl leukotriene CysLT(2) receptor.
10851239 2000 Characterization of the human cysteinyl leukotriene 2 receptor.
1085123 1976 L-Sorbose metabolism in Agrobacterium tumefaciens.