Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.00
PubTator Score 11.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
interstitial cystitis 2312 3.6e-03
psoriasis 6694 8.1e-03

Expression

  Differential Expression (2)

Disease log2 FC p
interstitial cystitis -1.200 3.6e-03
psoriasis -1.800 8.1e-03

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MSLLSLSWLGLRPVAASPWLLLLVVGASWLLARILAWTYAFYHNGRRLRCFPQPRKQNWFLGHLGLVTPT      1 - 70
EEGLRVLTQLVATYPQGFVRWLGPITPIINLCHPDIVRSVINTSDAITDKDIVFYKTLKPWLGDGLLLSV     71 - 140
GDKWRHHRRLLTPAFHFNILKPYIKIFSKSANIMHAKWQRLAMEGSTCLDVFEHISLMTLDSLQKCIFSF    141 - 210
DSNCQEKPSEYITAIMELSALVVKRNNQFFRYKDFLYFLTPCGRRFHRACRLVHDFTDAVIQERRRTLTS    211 - 280
QGVDDFLQAKAKSKTLDFIDVLLLSEDKNGKELSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEY    281 - 350
QERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCLKESLRLHPPIPTFARGCTQDVVLPDSRVIPKGNVC    351 - 420
NINIFAIHHNPSVWPDPEVYDPFRFDPENAQKRSPMAFIPFSAGPRNCIGQKFAMAEMKVVLALTLLRFR    421 - 490
ILPDHREPRRTPEIVLRAEDGLWLRVEPLG                                            491 - 520
//

Text Mined References (14)

PMID Year Title