Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.23
PubTator Score 7.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
urothelial carcinoma -1.500 3.0e-02
pancreatic ductal adenocarcinoma liver m... -1.458 6.9e-03
non-small cell lung cancer 1.685 1.1e-05
lung cancer 4.400 6.8e-06
interstitial cystitis -1.900 3.6e-05
cystic fibrosis 2.800 8.1e-07
Breast cancer -1.400 6.6e-04
psoriasis 2.100 8.6e-25

Gene RIF (6)

PMID Text
24138531 Microsomal menaquinone-4 omega-hydroxylation activities correlated with the CYP4F2 V433M genotype but not the CYP4F11 D446N genotype
20689807 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19812349 The CYP4F11 gene is positively regulated by multiple signaling pathways in HaCaT keratinocytes, including retinoid X receptor and JNK signaling pathways.
18976975 Knockdown of cytochrome P450, family 4, subfamily F, polypeptide 11 (CYP4F11) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18065749 3-hydroxystearate and 3-hydroxypalmitate are converted to omega-hydroxylated 3-OHDCA precursors in liver; CYP4F11 and, to a lesser extent, CYP4F2 catalyzed omega-hydroxylation of 3-hydroxystearate; CYP4F3b, CYP4F12, and CYP4A11 had negligible activity.

AA Sequence

MPQLSLSWLGLGPVAASPWLLLLLVGGSWLLARVLAWTYTFYDNCRRLQCFPQPPKQNWFWGHQGLVTPT      1 - 70
EEGMKTLTQLVTTYPQGFKLWLGPTFPLLILCHPDIIRPITSASAAVAPKDMIFYGFLKPWLGDGLLLSG     71 - 140
GDKWSRHRRMLTPAFHFNILKPYMKIFNKSVNIMHDKWQRLASEGSARLDMFEHISLMTLDSLQKCVFSF    141 - 210
ESNCQEKPSEYIAAILELSAFVEKRNQQILLHTDFLYYLTPDGQRFRRACHLVHDFTDAVIQERRCTLPT    211 - 280
QGIDDFLKNKAKSKTLDFIDVLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEY    281 - 350
QEQCRQEVQELLKDREPIEIEWDDLAQLPFLTMCIKESLRLHPPVPVISRCCTQDFVLPDGRVIPKGIVC    351 - 420
LINIIGIHYNPTVWPDPEVYDPFRFDQENIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALTLLHFR    421 - 490
ILPTHTEPRRKPELILRAEGGLWLRVEPLGANSQ                                        491 - 524
//

Text Mined References (16)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24138531 2013 Cytochrome P450-dependent catabolism of vitamin K: ?-hydroxylation catalyzed by human CYP4F2 and CYP4F11.
20689807 2010 Genetic variation and antioxidant response gene expression in the bronchial airway epithelium of smokers at risk for lung cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19932081 2010 Human cytochrome P450 4F11: heterologous expression in bacteria, purification, and characterization of catalytic function.
19812349 2010 Gene regulation of CYP4F11 in human keratinocyte HaCaT cells.
18065749 2008 Omega oxidation of 3-hydroxy fatty acids by the human CYP4F gene subfamily enzyme CYP4F11.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15364545 2004 Expression and characterization of human cytochrome P450 4F11: Putative role in the metabolism of therapeutic drugs and eicosanoids.
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10964514 2000 A novel human cytochrome P450 4F isoform (CYP4F11): cDNA cloning, expression, and genomic structural characterization.
9068972 1997 The cytochrome P450 4 (CYP4) family.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.