Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.43
PubTator Score 5.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 1.76939099098555E-18
ovarian cancer 8492 2.20380595734813E-15
malignant mesothelioma 3163 7.14948647809537E-9
Breast cancer 3099 8.85693743449832E-8
psoriasis 6685 1.11437600708246E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 1.52001561430961E-4
pilocytic astrocytoma 3086 3.02474454294112E-4
group 3 medulloblastoma 2254 0.00309766703334889
interstitial cystitis 2299 0.0181638680524588
chronic rhinosinusitis 512 0.0198683399355081
pediatric high grade glioma 2712 0.0203390152429922
osteosarcoma 7933 0.0228617724895948
invasive ductal carcinoma 2950 0.048272008602878

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -3.900 0.000
psoriasis -1.400 0.000
osteosarcoma 1.166 0.023
posterior fossa group A ependymoma 4.100 0.000
group 3 medulloblastoma 1.900 0.003
intraductal papillary-mucinous adenoma (... -2.100 0.000
interstitial cystitis -1.200 0.018
pediatric high grade glioma 1.100 0.020
pilocytic astrocytoma 2.000 0.000
Breast cancer -2.300 0.000
invasive ductal carcinoma -1.100 0.048
ovarian cancer -4.200 0.000
chronic rhinosinusitis -1.193 0.020

Synonym

Accession Q9NYL5 Q5VTT0 Q96FW5
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (4)

PMID Text
26475344 The CYP39A1 polymorphism rs7761731 may help to identify patients at high risk for treatment related toxicity.
24192117 GSTA1 and CYP39A1 were found to be associated with busulfan clearance. When combined, the two haplotypes explained 17% of the variability in busulfan clearance.
20453000 Observational study of gene-disease association. (HuGE Navigator)
19553612 The rs754203 SNP in CYP46A1 was associated with a risk for POAG. This polymorphism was not associated with changes in plasma 24S-hydroxycholesterol.

AA Sequence

MELISPTVIIILGCLALFLLLQRKNLRRPPCIKGWIPWIGVGFEFGKAPLEFIEKARIKYGPIFTVFAMG      1 - 70
NRMTFVTEEEGINVFLKSKKVDFELAVQNIVYRTASIPKNVFLALHEKLYIMLKGKMGTVNLHQFTGQLT     71 - 140
EELHEQLENLGTHGTMDLNNLVRHLLYPVTVNMLFNKSLFSTNKKKIKEFHQYFQVYDEDFEYGSQLPEC    141 - 210
LLRNWSKSKKWFLELFEKNIPDIKACKSAKDNSMTLLQATLDIVETETSKENSPNYGLLLLWASLSNAVP    211 - 280
VAFWTLAYVLSHPDIHKAIMEGISSVFGKAGKDKIKVSEDDLENLLLIKWCVLETIRLKAPGVITRKVVK    281 - 350
PVEILNYIIPSGDLLMLSPFWLHRNPKYFPEPELFKPERWKKANLEKHSFLDCFMAFGSGKFQCPARWFA    351 - 420
LLEVQMCIILILYKYDCSLLDPLPKQSYLHLVGVPQPEGQCRIEYKQRI                         421 - 469
//

Text Mined References (11)

PMID Year Title
26475344 2015 CYP39A1 polymorphism is associated with toxicity during intensive induction chemotherapy in patients with advanced head and neck cancer.
24192117 2013 Effect of genetic variants GSTA1 and CYP39A1 and age on busulfan clearance in pediatric patients undergoing hematopoietic stem cell transplantation.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
19553612 2009 Primary open-angle glaucoma: association with cholesterol 24S-hydroxylase (CYP46A1) gene polymorphism and plasma 24-hydroxycholesterol levels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
More...