Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.51
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.600 6.4e-03
facioscapulohumeral dystrophy 2.000 1.2e-02
primitive neuroectodermal tumor 2.500 1.9e-02
psoriasis 1.100 6.3e-08

Gene RIF (1)

AA Sequence

MRSVLRQRILKPKDVAIYSGEVNQVIADLIKRIYLLRSQAEDGETVTNVNDLFFKYSMEGVATILYESRL      1 - 70
GCLENSIPQLTVEYIEALELMFSMFKTSMYAGAIPRWLRPFIPKPWREFCRSWDGLFKFSQIHVDNKLRD     71 - 140
IQYQMDRGRRVSGGLLTYLFLSQALTLQEIYANVTEMLLAGVDTTSFTLSWTVYLLARHPEVQQTVYREI    141 - 210
VKNLGERHVPTAADVPKVPLVRALLKETLRLFPVLPGNGRVTQEDLVIGGYLIPKGTQLALCHYATSYQD    211 - 280
ENFPRAKEFRPERWLRKGDLDRVDNFGSIPFGHGVRSCIGRRIAELEIHLVVIQLLQHFEIKTSSQTNAV    281 - 350
HAKTHGLLTPGGPIHVRFVNRK                                                    351 - 372
//

Text Mined References (10)

PMID Year Title