Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.37
PubTator Score 169.52

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
aldosterone-producing adenoma -1.049 6.5e-03
Astrocytoma, Pilocytic 1.100 2.7e-07
ependymoma 1.300 4.5e-14
glioblastoma 1.300 4.5e-08
group 3 medulloblastoma 1.200 1.9e-04
malignant mesothelioma -1.200 9.5e-07
oligodendroglioma 1.100 4.8e-18
pediatric high grade glioma 1.400 9.6e-07
primitive neuroectodermal tumor 1.500 3.0e-05

Gene RIF (1)

AA Sequence

MLDFAIFAVTFLLALVGAVLYLYPASRQAAGIPGITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVS      1 - 70
FWFGRRLVVSLGTVDVLKQHINPNKTSDPFETMLKSLLRYQSGGGSVSENHMRKKLYENGVTDSLKSNFA     71 - 140
LLLKLSEELLDKWLSYPETQHVPLSQHMLGFAMKSVTQMVMGSTFEDDQEVIRFQKNHGTVWSEIGKGFL    141 - 210
DGSLDKNMTRKKQYEDALMQLESVLRNIIKERKGRNFSQHIFIDSLVQGNLNDQQILEDSMIFSLASCII    211 - 280
TAKLCTWAICFLTTSEEVQKKLYEEINQVFGNGPVTPEKIEQLRYCQHVLCETVRTAKLTPVSAQLQDIE    281 - 350
GKIDRFIIPRETLVLYALGVVLQDPNTWPSPHKFDPDRFDDELVMKTFSSLGFSGTQECPELRFAYMVTT    351 - 420
VLLSVLVKRLHLLSVEGQVIETKYELVTSSREEAWITVSKRY                                421 - 462
//

Text Mined References (13)

PMID Year Title