Property Summary

NCBI Gene PubMed Count 956
PubMed Score 3553.50
PubTator Score 2390.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
tuberculosis -2.100 1.2e-05
interstitial cystitis -2.900 2.7e-03
psoriasis -2.200 1.9e-12
gastric carcinoma -1.100 1.4e-02
head and neck cancer and chronic obstruc... -4.000 2.7e-02

Gene RIF (1100)

PMID Text
27090234 Data show a combined role of cytochrome P 450 1A1 (CYP1A1), Glutathione -S -transferase M1 (GSTM1) and T1 (GSTT1) polymorphisms and smoking status can be attributed for the cause of lung cancer.
26881514 CYP1A1 2454A > G polymorphism is associated with colorectal cancer risk.
26838244 No statistically significant overall association was found between breast cancer risk and CYP1A1 M2 genotypes.
26798414 the association of CYP1A1 M1 (rs4646903) and COMT (rs4680) polymorphisms in 130 cervical cancer cases (c-cancer) and 179 controls, is reported.
26782595 The CYP1A1 gene deletion is a lung cancer risk factor, and interacts with smoking in non-small cell lung cancer development.
26782562 CYP1A1 and GSTM1 gene polymorphisms affect familial aggregation of esophageal cancer among the Kazakh ethnic group in Xinjiang.
26782546 A significant association between the frequency of the CYP1A1 polymorphism and the development of cervical cancer.
26782431 polymorphisms in CYP2E1 (PstI) and CYP1A1 (MspI) were not associated with sporadic colorectal cancer in the evaluated Brazilian population.
26681006 The allelic variation frequency of the CYP1A1 gene at exon 7 (Ile 462 Val) in bone tumor patients was significantly higher than that in control.
26643992 CYP1A1 expression in 3D spheroids of liver cancer cells is regulated by AhR and PXR.
26598080 CYP1A1 A4889G and T6235C polymorphisms alter the risk and clinical or tumor characteristics of breast cancer among a heterogeneous population from Southeastern Brazil.
26514676 This study evaluated the expression of FGF7, AhR, and CYP1A1 in colorectal cancer cells and revealed a new mechanism by which KGF promotes cell proliferation through the AhR-cyclin D1 pathway in colon cancer cells.
26514474 The result indicates that the risk of Head and Neck Cancer associated with tobacco and alcohol is modulated by CYP1A1 T3801C polymorphism.
26483235 CYP1A1*2A polymorphism may be associated with the genetic susceptibility to childhood acute lymphoblastic leukemia
26474839 Aryl hydrocarbon receptor (AhR)-siRNA knockdown in human esophageal cells supported the hypothesis of AhR-mediated CYP1A1 induction by alternariol (AOH). However, DNA damage was minor at CYP1A1-inducing AOH concentrations.
26425562 the association between CYP1A1 polymorphisms and chronic obstructive pulmonary disease risk, is reported.
26367467 These findings suggest the Gly45Asp substitution results in a structural disturbance of CYP1A1, reducing its holoenzyme formation and catalytic activity.
26187180 Cannabidiol may induce human CYP1A1 expression through the activation of protein tyrosine kinase-dependent aryl hydrocarbon receptor signaling.
26166128 The results demonstrated that CYP1A1 rs4646903 and null genotype of GSTM1 polymorphisms might serve as risk factors for oral cancer
26123186 data show that in the leukocytes with mutant alleles treatment with 17beta-E2 up-regulates CYP1A1 and CYP1B1 and down-regulates COMT mRNA levels, resulting in major increments in 4-OHE2 levels
25934798 A model for integration between Wnt/beta-catenin and aryl hydrocarbon receptor signaling for gene induction of the CYP1A1 promoter.
25886559 meta-analysis provides evidence that CYP1A1 MspI polymorphism may contribute to esophageal cancer development in the Chinese population
25798582 Hypermethylation of CpG island of CYP1A1 promoter and polymorphism is associated with anti-tuberculosis drug-induced liver injury.
25735346 CYP1A1 gene variants are associated with the risk of developing oral cancer in tobacco addicted patients.
25730047 In conclusion, the 3801 TC polymorphism in the CYP1A1 gene may be related to increased risk of hepatocellular carcinoma in Asians
25724184 Smokers carrying CYP1A1 TC/CC + GSTM1 null and CYP1A1 TC/CC + GSTT1 null genotypes showed significant association with head and neck cancer risk
25654087 The aim of the study was to assess whether selected single nucleotide polymorphisms of CYP1A1 and 2E1, GSTM1, GSTT1, and SULT1A1 influence susceptibility towards hepatocellular carcinoma.
25630554 The CYP1A1 MspI polymorphism significantly increased renal cell carcinoma (RCC) risk, while the Ile462Val polymorphism was not associated with RCC.
25501250 These CYP1A1m1 polymorphisms may be risk factors for primary open-angle glaucoma.
25399436 CYP1a1 expression is a potential mechanism for the protective effect of estradiol in hyperoxia-exposed immature lung, which may help explain the sex difference in neonatal lung diseases.
25343551 The CYP1A1 Ile462Val variant was associated with a low risk of developing non-small cell lung cancer in a Chinese population.
25306702 Molecular genetic markers of predisposition to the development of thyroid disease are: GG genotype and allele G gene DIO2 (274A > G), CT and CC genotypes of the gene CYP1A1 (-3798T > C), associated with the development of nodular goiter
25304467 Genetic variations in CYP1A1 and CYP1B1 and the serum levels of 25(OH)D showed synergistic effect on blood pressure, especially in individuals currently in treatment for hypertension.
25299844 CYP1A1 mRNA expression is strongly associated with the expression of thyroid hormone regulated target gene mRNAs in human placenta
25281494 Women who were polymorphic for CYP1A1 experienced an HR-HPV clearance rate that was 20% lower than women without the polymorphism for CYP1A1. The GSTM1 null genotype was associated with higher HR-HPV clearance rate.
25245543 The higher level of r7, t8, t9-trihydroxy-c-10-(N(2)-deoxyguanosyl)-7,8,9,10-tetrahydro-benzo[a]-pyrene in MCF-7 cells, compared to normal human mammary epithelial cell, may have been due to a much increased induction of CYP1A1 and EROD.
25189712 Both rs4886605 and rs12441817 SNPs of the CYP1A1 gene are associated with coronary artery disease in the Uygur population of China.
25169514 The findings suggest that presence of the 'C' allele of rs4646903 (T>C) of the CYP1A1 gene may be one of the risk alleles for esophageal cancer susceptibility in Pashtun population
25150952 There was no difference in the distribution of the CYP1A1 Mspl (p = 0.86) and CYP17 genotypes (p = 0.12) between the precocious puberty and normal puberty groups.
25138301 The current study demonstrates that the CYP1A1 and CYP2D6 polymorphisms are associated with susceptibility to both development and progression of HNSCC.
25131582 The colon tumors in hCYP1A mice mimic human colorectal carcinogenesis.
25106409 CYP1A1*2A polymorphism is associated with oral cancer among the smoking subjects.
25068733 Suggest that CYP1A induction by coplanar polychlorinated/brominated biphenyls depends on AhR transcriptional activity and not on AhR expression.
25048966 results suggested that the CYP1A1 Ile/Val polymorphism was associated with an increased risk of esophageal cancer, whereas the CYP1A1 MspI polymorphism may not have increased susceptibility to esophageal cancer
25040976 To identify the genotypes of CYP1A1, GSTM1, GSTM3, GSTT1 and GSTP1 in a case-control study.
25011215 Increase of CYP1A1 mRNA level may not only reduce the carcinogenicity of foreign compounds, but may also activate some cardinogens.In case of transporters, an increase of their expression in the body may lead to increased fetoprotection.
24969905 There was no association between CYP1A1 Msp I polymorphisms and digestive tract cancer risk.
24957043 the data suggest a putative downregulation of CYP1A1 and CYP1B1 expression in endometrial tumors
24945098 A significant association between CYP1A1*2C and high triglyceride levels in Amerindian Tarahumaras from Chihuahua has been found; this allele was significantly associated with normal triglyceride levels in Tepehuanos from Durango, Mexico.
24939416 CYP1A1 Ile462Val polymorphism was statistically significant risk factor in Polish colorectal cancer patients over 50 years old.
24938875 Data indicate that both cytochrome P450 1A1 (CYP1A1) MspI and glutathione S-transferase M1 (GSTM1) genetic polymorphisms were independently associated with the risk of lung cancer.
24935599 The present meta-analysis suggests that CYP1A1 polymorphism is not associated with bladder cancer risk.
24926919 CYP1A1 rs2470893 is significantly related to polychlorinated biphenyl PCB118 levels following strict adjustment for multiple testing.
24875910 Data of genetic polymorphism of CYP1A1, CYP1B1 and CYP17 are presented. The association of the gene polymorphisms and organochlorine pesticide blood levels in benign prostatic hyperplasia patients is explored.
24851608 We did not observe association of mutated allele with prostate cancer risk, nor with cancer aggressiveness.
24841653 the CYP1A1 MspI and TNFalpha-308 polymorphisms were associated with COPD susceptibility. Furthermore, of the two polymorphisms, only TNFalpha-308 may exert an interaction with smoking.
24777039 Single mucleotide polymorphisms in three estrogen metabolite enzymes (COMT, CYP1A1, CYP1B1) were found in a Chinese population. Some polymorphisms were risk factors for uterine leiomyoma and some were protective factors against it.
24671854 CYP1A1 polymorphisms are associated with chronic myeloid leukemia.
24668907 this is the first report of CYP1A1*2A as a possible protective variant against gastroschisis in the offspring of women who smoke during the periconceptional period
24657182 results suggest that presence of the 'C' allele of m1 (T>C) and 'G' of m2 (A>G) may be risk alleles for cervical cancer susceptibility. CYP1A1 m1 and m2 polymorphisms show considerable association with tobacco smoking in the study population.
24647742 CYP1A1 expression is up-regulated in aortic aneurysms.
24629213 The BRCA1 founder mutation and polymorphisms in CYP1A1 and CYP17 can increase the breast cancer risk among Inuit women, and the risk increases with higher serum levels of perfluorooctane sulfonate and perfluorooctanoic acid.
24626963 this genetic study suggests that the CYP1A1 Ile462Val SNP may be a risk factor for cervical cancer among patients with a positive history of tobacco smoking and parity
24613751 CYP1A1 m1 and m2 polymorphisms contribute to smoking related lung cancer risk in the Egyptian population
24585908 Carcinogens in smoke increase cytochrome P450 1A1 activity, which might be considered to play a role in cigarette smoking-induced lung cancer.
24583342 The effects of palmitine on aryl hydrocarbon receptor, CYP1A1 and CYP1A2 expression in hepatocytes and HepG2 cells are reported.
24552248 findings provide convincing evidence that CYP1A1 genetic polymorphisms may contribute to susceptibility to bladder cancer, especially for 11599G>C, 2455A>G, 3810T>C, and 113T>C polymorphisms among Asians
24535777 CYP1A1 polymorphisms may confer increased risk of gallbladder cancer, probably due to impaired xenobiotic or hormone metabolism through a gallstone-independent pathway
24527758 believe that the findings are the first results of CYP allele distributions in the Turkish population and provide an understanding of the epidemiological studies that correlate therapeutic approaches and etiology of CRC especially in Turkish patients
24508281 Our results suggest that the GSTM1non-null, GSTT1null, and CYP1A1*2A genotypes may be good prognosis markers in patients with prostate cancer
24504680 CYP1A1 Val/Val and CYP2E1 c1/c1 genotypes are significantly associated with esophageal squamous cell carcinoma risk.
24498651 The participation of CYP1A1 T3801C is a genetic susceptibility for some cancer types.
24488272 Interaction between metabolic rates of phytoestrogens and genetic polymorphisms of CYP2B6, CYP1A1, and NAT2 in male infertility.
24466186 A significant association between CYP1A1 3801T>C polymorphism and idiopathic male infertility risk.
24460333 CYP1A1 exon-1 gene mutation is associated with tobacco use disorders.
24460273 High expression of CYP1A1 is associated with brain tumor.
24449363 Genetic polymorphisms in CYP1A1 and CYP2D6 may significantly associate with HNC in the Tunisian population.
24443269 suggests no associations between CYP1A1 Ile462Val polymorphism and gastric cancer, but possible associations between CYP1A1 MspI and CYP1A2*1 F polymorphisms and gastric cancer
24391993 CYP1A1 MspI and Ile462Val polymorphisms contribute to increased cancer susceptibility among Asians.
24382322 Data indicate that TCDD or omeprazole caused protein phosphatase 2A (PP2A)-mediated dephosphorylation of Sp1 transcription factor at Ser-59 and induced CYP1A1 transcription.
24377558 Genetic polymorphisms of CYP1A1 may increase the susceptibility to esophageal cancer.
24358191 Mean mRNA levels of CYP1B1 and CYP1A1 along with mean CYP1 activity were higher in bladder and colon tumors compared to normal tissues
24355420 Our results show that aryl hydrocarbon receptor activation and CYP1A1 expression induced by PCB 126 were significantly inhibited by hypoxia.
24320736 genetic association studies in Han Chinese population in Nanjing: Data suggest that SNPs in CYP1A1 (Ile462Val/rs1048943; Gly45Asp/rs4646422) are associated with susceptibility to uterine leiomyoma in the population studied.
24316127 these results support that the CYP1A1 2A genotype polymorphism mainly contributes to idiopathic male infertility susceptibility in Asians but not in Caucasians.
24307623 meta-analysis suggests the participation of A2455G of CYP1A1 in the susceptibility for some cancers, such as breast cancer, colorectal cancer, lung cancer, and so on
24168324 Only CYP1A1, CYP1B1, CYP3A4, CYP3A5 and CYP3A7 expressed in lymphocytes and monocytes.
24096584 CYP1A1 may be associated with breast cancer
24091107 Dexamethasone suppresses CYP1A1 transactivation by aryl hydrocarbon receptor ligands in JEG-3 cells.
24084344 The only polymorphism that stands out in our study which examined cytogenetic damage in Turkish coke oven workers exposed to polycyclic aromatic hydrocarbons,is the wild-type CYP1A1 exon 7 which was associated with a signifi cantly higher CBMN frequency
24068433 the CYP1A1 (rs2606345, rs4646903, rs1048943), GCLC, AGT, and AGTR1 genes was associated with pleuritis, empyema, acute respiratory distress syndrome, all PC and acute respiratory failure (ARF).
24065535 This meta-analysis demonstrated distinct evidence that CYP1A1 A2455G polymorphism was associated with the risk of esophageal cancer.
23918309 CYP1A1 MspI polymorphism is not associated with endometrial cancer risk. [Meta-analysis]
23886179 High CYP1A1 expression is associated with colorectal cancer.
23873331 The expression of CYP1A1, CYP1B1 and mitochondrial superoxide dismutase MnSOD (both mRNA and protein) in a panel of eight commonly used cancer cell lines, were examined.
23870476 CYP1A1 polymorphisms is associated with invasion and metastasis of breast cancer.
23860774 Studies suggest that CYP1A1 A4889G polymorphism is not associated with endometrial cancer risk.
23852617 This meta-analysis suggests that CYP1A1 MspI polymorphisms may contribute to increasing susceptibility to PCOS among Caucasian populations.
23848208 The current meta-analysis indicates that the CYP1A1 rs4646903 (T>C) polymorphism may contribute to increasing susceptibility to PCOS, especially among the general female population in Turkey and India.
23842721 Breast cancer patients carrying CYP1A1 gene polymorphisms developed less aggressive tumors, but showed no evidence of better prognoses
23840148 Combination of the CYP1A1 2C and NQO1 609CC genotypes was associated with a decreased risk of colorectal adenomas regardless of smoking status.
23832578 Studies suggest that CYP1A1 exon7 polymorphism correlated with increased lung cancer susceptibility and there is an interaction between CYP1A1 exon7 polymorphisms and smoking, but these associations vary in different genders.
23816456 findings suggest that polycyclic aromatic hydrocarbons exposure producing 1-hydroxypyrene as a metabolite compromises lung function in the elderly, and that haplotype-based CYP1A1 polymorphism modifies the risk
23785672 Our data provide new information on gene polymorphisms in Greenlandic Inuit
23733671 The rs17861094 (I78S) was identified to probably be the candidate ns-SNP with three other ns-SNPs, rs149687459 (R241C), rs34260157 (R271W), and rs191792412 (R355W) being highly deleterious in CYP1A1 gene.
23725389 Our results suggest that polymorphic variants in the CYP1A1*4 gene may increase the risk of childhood ALL, particularly in male patients aged 2-10 years.
23707957 A meta-analysis to investigate single nucleotide polymorphisms in the CYP1A1 subfamily for leukemia risk showed moderate risk for the CYP1A1*2A variant with ALL in children. The CYP1A1*2C polymorphism showed moderate risk for adults.
23661361 An increased risk of brain tumors was evident for CYP1A1 rs2606345 and minor haplotypes rs2606345-rs1048943-rs4646903 in females.
23619522 This is the first study to establish the association of CYP1A1*2A and *2C polymorphism with chronic kidney disease in north-Indian population.
23576571 CYP1A1 promotes breast cancer proliferation and survival.
23548414 Study has confirms the association of CYP1A1*2C polymorphism with idiopathic male infertility and shows that the relationship between the gene and the susceptibility to the disease depends on male's smoking habit.
23528250 A polymorphism in CYP1A1 (rs4646903) was associated with maternal dioxin concentrations in pregnant Japanese women.
23508959 Human cytochrome P450 1A1 structure and utility in understanding drug and xenobiotic metabolism
23492908 CYP1A1/CYP1A2 rs2472297C>T and AHR rs4410790C>T are potentially useful genetic markers associated with variability in CYP1A2-mediated metabolism, but are of minor quantitative importance for systemic OLA exposure.
23475304 CYP1A1 MspI polymorphism is associated with prostate cancer susceptibility.
23471717 A three-order interaction of CYP1A1, CYP2A6, and CYP2D6 polymorphisms appears to increase genetic susceptibility to lung cancer in patients from central south China.
23462525 These findings reveal that the functional CYP1A1 MspI genetic variant, alone and in combination with smoking, plays a more important role in pathogenesis of head and neck cancers.
23444898 The results revealed that the polymorphic variants of CYP1A1 gene did not show association towards oral cancer risk
23424205 The results demonstrated that 50 microg/mL beta-glucan significantly repressed the expression of the ERCC5 gene, no change in CASP9 expression, and induction of the CYP1A1 gene.
23419638 Pelargonidin can bind to and activate the AhR and AhR-dependent gene expression, and induce the CYP1A1 catalytic activity.
23411129 Functional polymorphisms in the CYP1A1, ACE, and IL-6 genes contribute to susceptibility to community-acquired and nosocomial pneumonia.
23381648 There is an association between CYP1A1 Ile462Val polymorphism and increased risk of prostate cancer.
23369756 these results demonstrate for the first time that there is a differential modulation of the TCDD-mediated induction of Cyp1a1 by As(III) in C57BL/6 mouse livers and isolated hepatocytes.
23353840 Human cytochrome P450 (CYP) 1A1 and 1A2 enzymes were found to be responsible for the aristocolochic acid I reductive activation to form AAI-DNA adducts, while its structurally related analogue, CYP1B1 is almost without such activity.
23350368 The article reviews the relationship between polymorphism of sex hormone-related genes (CYP17, CYP19, CYP1A1, COMPT, ERalpha, ERbeta and others).
23293967 Significant increase in urinary 8-OHdG levels in mutated CYP1A1 genotypes.
23288144 Sunitinib, a tyrosine kinase inhibitor, induces cytochrome P450 1A1 gene in human breast cancer MCF7 cells through ligand-independent aryl hydrocarbon receptor activation.
23259321 This study demonstrated the association of CYP1A1 haplotypes and GSTT1 null variant with CAD risk and this association was attributed to increased oxidative DNA damage.
23229202 CYP1A1 T6235C polymorphism is not correlated with coronary artery disease risk.
23178447 results indicate that the CYP1A1*2B allele (rs4646903 and rs1048943) is associated with an increased lung cancer risk and CYP2A6*4 is associated with a decreased lung cancer risk in the Bangladeshi population
23174221 Beta-catenin signaling induces CYP1A1 expression by disrupting adherens junctions in Caco-2 human colon carcinoma cells.
23152866 The combined genotypes of CYP1A1 and GSTs can help to identify vulnerable pregnant women who are subject to high risk of spontaneous preterm delivery due to passive smoking.
23124075 CYP1A1 and CYP2E1 gene polymorphisms may increase risk of the oral submucous fibrosis among Eastern Indians.
23111888 CYP1A1 genetic variants contribute to interindividual variability in smoking- and hypertension-induced ischemic stroke risk.
23098461 CYP1A1 Ile462Val polymorphism is not associated with endometrial cancer.
23065291 The T6235C single nucleotide polymorphism in the human CYP1A1 gene is not associated with increased risk of developing acute lymphoblastic leukemia.
23065259 The 2455A>G polymorphism of CYP1A1 results in a significantly increased susceptibility to prostate cancer in all genetic models. [Meta-analysis]
23056546 CYP1A1 Ile462Val polymorphism might be a low-penetrant risk factor for acute leukemia
23055196 this meta-analysis demonstrates a significant association between the CYP1A1 T3801C polymorphism and cervical neoplasia susceptibility
23046808 Data suggest that maternal obesity down-regulations placental microsomal CYP1A1 activity (but not placental cytosolic CYP1A1 activity). Similar results were obtained for CYP1A1 activity in fetal livers from obese/non-obese Japanese macaques.
23033491 In mice-bearing human CYP1A1-positive and negative isogenic tumors, ICT2700 administration resulted in an antitumor response only in the CYP1A1-expressing tumor model.
23013535 Results suggest that genetic polymorphisms in the CYP1A1, GSTM1, GSTT1 and GSTP1 metabolic genes were not significantly associated with lung cancer risk.
23000097 We found that CYP1A1 rs1048943 and GSTP1 rs1695 polymorphisms are associated with a significantly increased breast cancer risk.
22997752 CYP1A1 Ile462Val polymorphism is associated with dystrophic eye diseases.
22994769 Significant association of CYP1A1 m1 and m2 heterozygous (wt/mt) +homozygous (mt/mt) variants with genetic damage.
22964275 Results suggest that CYP1A1 MspI polymorphism might be a risk factor for acute lymphoblastic leukemia (ALL), particularly childhood ALL.
22952673 CYP1A1 Ile462Val polymorphism contributes to lung cancer susceptibility among lung squamous carcinoma and smokers [meta-analysis]
22951721 These data clearly indicate that repressed CYP1 activity in primary human skin fibroblasts is not causally related to AhRR expression, which may serve a different, yet unknown, biological function.
22949628 Both compounds displayed similar binding orientations within the active site of CYP1A1 and CYP1A2.
22948778 CYP1A1 Ile462Val polymorphism is associated with cervical cancer.
22918668 Carcinogen detoxifying genes may be involved in pathogenesis of head and neck cancer. Immunohistochemistry data showed that CYP1A1 and GSTT1 was down expressed whereas GSTP1 was over expressed in HNC tissues compared with adjacent normal control tissues.
22909097 CYP1A1*2A polymorphism might be a low-penetrant risk factor for oral carcinoma, particularly among Asians.
22901117 Down-regulation of CYP1A1 expression is associated with breast cancer.
22893352 Report possible associations between CYP1A1 gene polymorphism and the risk of lung cancer.
22876118 CYP1A1 expression in pterygium correlates with allelic variation and can be used as an independent risk marker.
22855999 Association of polymorph variants of CYP1A1 and CYP1A2 genes with reproductive and thyroid diseases risk in female workers of petrochemical industry
22854411 genetic association studies in a Costa Rican population: Previous associations observed between an SNP in CYP1A1 (rs2472297) and caffeine/coffee consumption in European populations are also observed in an ethnically distinct Costa Rican population.
22847262 Cytochrome P450 1A1 Ile462Val polymorphism is associated with oral carcinoma.
22846179 CYP1A1 MspI polymorphism might be a risk factor for AML among Asians
22837390 VDR directly bound to an everted repeat (ER) 8 motif in the human CYP1A1 promoter.
22782580 There were no significant differences in CYP1A1-MspI SNP and GSTM1 genotype frequencies in this family when compared to data for Brazilian populations.
22754477 No statistically significant interactions between breast cancer risk, fungicide exposure and CYP1A1*2A were observed
22752755 CYP1A1 m1 and m2 genotypes singly act as protective factors but in the absence of GSTM1 and/or GSTT1 gene significantly alters risk towards oral submucous fibrosis.
22733497 Cytochrome P450 1A1 (CYP1A1) gene polymorphisms and ovarian cancer risk
22707145 the CYP1A1 polymorphism itself, either m1 or m2, did not represent an independent genetic risk factor influencing gastric cancer.
22664944 The CYP1A1*2A (T/C, C/C), mEPHX*3 (His/His), GSTM1 (null), GSTT1 (null) and XRCC1 399 (Arg/Gln, Gln/Gln) alleles correlate with an increased predisposition to ulcerative colitis.
22660220 CYP1A1 significantly alter oral cancer risk
22611936 The genetic polymorphisms of CYP1A1-exon7, GSTM1, XRCC1-194 and XRCC1-280 might contribute to the risk of developing lung cancer in Henan population.
22594779 Cytochrome 1A1 and .... gene diversity in the Zanzibar islands
22579698 This meta-analysis suggests that the MspI polymorphisms of CYP1A1 correlate with increased lung cancer susceptibility.
22470100 miR892a inhibited the expression of the CYP1A1 protein
22448487 The role of mutation of gene cyp1A1 and benzapilene in cytogenetic changes of urinary tract epitheliocytes in oil industry workers employed in the oil fields of the North of West Siberia
22442665 the presence of ligands for TLR2 of bacterial origin seems to be crucial for detoxication of luminal carcinogens by CYP1A1 in the intestine.
22422552 Quercetin induces AhR activation and CYP1A1 transcription in transfected HepG2 cells. Quercetin and taxifolin increase CYP1A1 mRNA levels in HepG2 cells.
22395499 anlysis of the codon 72 polymorphism of p53 gene and Ile/Val polymorphism of CYP1A1 gene in women with ovarian cancer in a Romanian population
22392998 prolonged induction of AHR activity through inhibition of CYP1 disturbs feedback regulation of FICZ levels, with potential detrimental consequences
22384629 The presence of mutated CYP1A1 polymorphic variants influencing the CYP1A 1 activity could be responsible for different interindividual susceptibility to genital cancers in women.
22374940 Carnosol, a constituent of Zyflamend, inhibits aryl hydrocarbon receptor-mediated activation of CYP1A1 and CYP1B1 transcription and mutagenesis
22365406 There is no correlation between CYP1A1MspI gene polymorphism and the susceptibility of childhood AL.[review]
22359202 Studies indicate that CYP1A1 MspI polymorphism was not associated with gastric cancer risk.
22312901 Enhanced predisposition to community-acquired pneumonia was shown to be characteristic of homozygotes in allele 606T of the CYP1A1 gene (OR = 1.6; p = 0.020).
22311486 CYP1A1 mutant genotype and GSTM1 null genotype with smoke has increased the risk of lung cancer, with OR being 2.406(1.321-4.382), 2.755(1.470-5.163), respectively.
22304463 unable to demonstrate any significant association between the studied CYP1A1 polymorphism, age, tobacco use, and tumor parameters of aggressiveness at diagnosis.
22297691 Polymorphisms of CYP1A1 may play important roles in increasing susceptibility to smoking-related hepatocellular carcinoma. [Meta-analysis]
22296350 CYP1A1 Wt/Vt and Vt/Vt to confer a significantly greater risk than CYP1A1 Wt/Wt.
22294106 Both MspI and Ile462Val polymorphisms in the CYP1A1 gene seemed capable of conferring additional risk for cervical cancer. [Meta-analysis]
22292665 The genotype distribution of CYP1A1*1 in cancer patients was 6% for homozygous.
22281432 Data indicate that the CYP1A1 (val) "variant" genotype increased the risk of renal cell carcinoma (RCC), whereas, the CYP2D6 polymorphism did not show any association with RCC risk.
22277800 Overall, Ile(462)Val was significantly associated with ovarian cancer, with homozygous carriers (Val/Val vs. Ile/Ile: and recessive model (Val/Val vs. Ile/Ile and Ile/Val being risk factors for ovarian cancer development.
22273851 CYP1A1 polymorphisms are associated with development of head and neck cancers.
22236719 Report no association among environmental tobacco smoke exposure, asthma, and CYP1A1 polymorphisms in a population of children from Northern Mexico.
22217397 Combination of smoking and either the CYP1A1 rs4646903 genotype or the combined metabolic genotype plays an important role in systemic lupus erythematosus susceptibility in a Japanese population.
22213191 low levels of DNA methylation of the CYP1A1 enhancer in histologically normal human lung were associated with high CYP1A1 mRNA levels and with smoking-induced genetic alterations
22183307 Endogenous DNA damage levels were analyzed in relation to polymorphisms in genes encoding phase I detoxifying enzyme-CYP1A1, phase II detoxifying enzymes-GSTM1, GSTT1, GSTP1 and enzyme involved in nucleotide excision repair-XPD.
22154617 TP53 mutation and CDKN2A methylation specifically interact to promote lung tumorigenesis in subjects with CYP1A1 risk genotype.
22109568 Non-small-cell lung cancer patients with TT CYP1A1 were better responders to nonplatinum drugs.
22088806 results suggest that AG genotype of CYP1A1 in Chaoshan area of China and GG (CC) genotype of CYP2E1 in Taihang area are significantly associated with esophageal cancer susceptibility
22086975 Report bioactivation versus detoxication of the urothelial carcinogen aristolochic acid I by human cytochrome P450 1A1 and 1A2.
22025136 This meta-analysis suggests that the CYP1A1 IleVal polymorphism might play a modest role in susceptibility to lung cancer, especially in Asians.
22018952 Data suggests that GSTM1 null genotype alone and in combination with CYP1A1 m1 genotype may be predisposing risk factors for PV in the Jordanian population.
22000673 polymorphisms of cytochrome P450 mono-oxygenase are weakly associated with clear cell renal cell carcinoma risk in Chinese subjects.
21977969 Women in Siberia with SNPS in CYP1A1 gene, in CYP1A2 gene,and in the SULT1A1 gene have an increased risk of development of breast cancer .
21876539 Genome-wide association analysis of coffee drinking suggests association with CYP1A1/CYP1A2 and NRCAM
21870186 Data show that inherited combined CYP1A1 A4889G and T6235C abnormalities and GSTM1 and GSTT1 pathways are important determinants of HNSCC.
21869479 Role of CYP1A1 (T6235C) polymorphism and cigarette smoking in the development of coronary heart disease in Tunisian population
21859547 The combined effects of CYP1A1 gene and GSTM1 gene polymorphism are significantly associated with an increased risk to lung cancer.
21848428 Individuals carrying CYP1A1 variant GSTT1 null genotypes had an 8.907-fold increased coronary artery disease risk compared to their wild status.
21775774 An association between male infertility and the GSTM1 and GSTT1 null deletion was observed, but not with the CYP1A1 polymorphism in North Iranian men with idiopathic infertility.
21718208 CYP1A1 genotype was not associated with disease status in a pesticid exposed rural population in Greece.
21710246 This meta-analysis suggests that CYP1A1 Ile ( 462 ) Val polymorphism was a low-penetrance susceptibility gene in colorectal cancer development.
21709011 CYP1A1 Ile/Ile genotype with GSTM1 null genotype combination may contribute to the development of bladder cancer in this Turkish population.
21590276 CYP1A1 MspI polymorphism has no association with the development of head and neck cancer.
21586621 Our study provides a novel and specific link between CYP1A1 polymorphisms and ethnic influence on Acute lymphoblastic leukemia risk
21545219 Genetic changes in CYP1A1 is associated with oral cancer progression.
21545198 CYP1A1 downregulation is associated with head and neck cancer progression.
21508386 Polymorphisms of the CYP1A1, CYP2E1 and XRCC1 genes are not asociated with cancer.
21438753 the associations between soy isoflavone intake and the CYP1A1 Ile462Val, CYP1B1 Val432Leu, and COMT Val158Met polymorphisms and breast cancer
21418988 The CC genotype and C allele of 6235T-C polymorphism of CYP1A1 may be linked with breast cancer with abnormal Sapra Hilit and abnormal savda Hilit in Chinese Han population of Xinjiang province.
21402622 The MspI and Ile-Val polymorphism of CYP1A1 is a risk factor associated with increased lung cancer susceptibility, but these associations vary in different ethnic populations.
21385088 CYP1A1, gene polymorphisms and susceptibility to colorectal and gastric cancer among Lebanese
21357676 AHR detects xenobiotics, such as polycyclic aryl hydrocarbons found in roasted coffee, and induces transcription of CYP1A1 and CYP1A2.
21329749 Ginkgo biloba extracts may disturb intestinal CYP1A1 activity and, in turn, affect the metabolism of other compounds.
21304969 serum induces CYP1A1 via the PPARalpha pathway and hexanal is one of the serum inducers. The two PPRE sites within the CYP1A1 promoter are functional and one of them is specific for PPARalpha
21270613 The 3 examined CYP1A1 genotype polymorphisms do not seem to confer any additional risk for endometrial cancer in Caucasians.
21262253 In a reporter gene assay administration of tanshinones resulted in an induction of cytochrome P450, CYP1A1 (and CYP1A2).
21254556 Cytochrome P4501A1, glutathione S-transferase M1 and T1 gene polymorphisms in chronic myeloid leukemia
21254355 Our results suggest that there is an association between CYP1A1 and an interaction between EPHX1 and NAT2 xenobiotic metabolism genes and an increased risk for clubfoot.
21246002 CYP1A1 Ile462Val may be an increased risk factor for colorectal cancer [meta-analysis]
21211368 The combination of CYP1A1 polymorphisms with cooking oil fume increased the risk of female lung cancer.
21130723 Single Nucleotide Polymorphism in CYP1A1 is associated with endometrial cancer.
21086258 found no significant association of CYP1A1m1 and CYP1A1m2 genotypes with thyroid diseases
21086258 Observational study of gene-disease association. (HuGE Navigator)
21081473 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20970553 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20965504 The data show an association between CYP1A1 and polycystic ovary syndrome (PCOS), indicating that variant alleles of the gene may affect the metabolic and transport pathway of estrogens, thus causing PCOS
20965504 Observational study of gene-disease association. (HuGE Navigator)
20962519 Increased risk for acute lymphoblastic leukemia in children with cytochrome P450A1 (CYP1A1)- and NAD(P)H:quinone oxidoreductase 1 (NQO1)-inherited gene variants.
20962519 Observational study of gene-disease association. (HuGE Navigator)
20957336 Observational study of gene-disease association. (HuGE Navigator)
20937634 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20887941 Data demonstrates that CYP1A1 is an important determinant in susceptibility to tobacco-induced head and neck carcinogens and there is an association between genetic polymorphism in the CYP1A1 locus and elevated risk of the type of smoking among Indians.
20887941 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20886582 Single nucleotide polymorphisms of CYP1A1 is associated with colorectal cancer.
20886582 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20884258 The study showed absence of association for CYP1A1 2B, CYP1B1 2, GSTM1 0, and GSTT1 0 for prostate cancer
20884258 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20883830 Data suggest that risk of estrogen-mediated diseases might be not only influenced by CYP1A1 genotype-dependent activation but also its inhibition by natural polyphenols of diet and drugs.
20878621 No association between CYP1A1 4889 A>G (rs1048943) & breast cancer was found. However, the CYP1A1 (3801 T>C) m2/m2 genotype may contribute to breast cancer susceptibility in Mexican women.
20878621 Observational study of gene-disease association. (HuGE Navigator)
20878561 Genetic polymorphisms of CYP1A1 is not associated with gastric carcinoma.
20878561 Observational study of gene-disease association. (HuGE Navigator)
20855412 Child behavioral problems may be associated with prenatal ETS exposure, and this effect may be modified by infant CYP1A1 MspI and CYP1A1 Ile462Val genes
20855412 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20850372 Observational study of gene-disease association. (HuGE Navigator)
20846153 Hypermethylation of CYP1A1 showed significant association with head and neck cancer. Significant interaction between smoking and methylation status of CYP1A1 in head and neck cancer.
20846153 Observational study of gene-disease association. (HuGE Navigator)
20845989 Observational study of gene-disease association. (HuGE Navigator)
20817259 Lack of correlation between prostate cancer and CYP1A1 polymorphisms.
20817259 Observational study of gene-disease association. (HuGE Navigator)
20804547 CYP1A1 gene polymorphisms are associated with lung cancer.
20804547 Observational study of gene-disease association. (HuGE Navigator)
20734807 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20723587 Observational study of gene-disease association. (HuGE Navigator)
20704749 Combined effects of cigarette smoke and CYP1A1 Polymorphisms are associated with non small cell lung cancer.
20704749 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20701904 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20700368 The differences in DNA adduct levels in pterygium were associated with the genetic polymorphisms of CYP1A1 but not GSTM1.
20664892 genetic polymorphisms affect the risk of developing venous thromboembolism in smoking Chinese patients
20664892 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20661821 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20644561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20638923 Findings suggested that CYP1A1 or GSTM1 variants may significantly modify the associations between level of serum trace metals (Cu, Zn, Se or Cr) and NSCLC, indicating the intriguing pathogenesis of lung cancer.
20638923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20628863 Only NAT1 showed a significant lower DNA methylation rate in the control group than in the tamoxifen-resistant breast cancer group, and no significant difference in methylation was found in COMT, CYP1A1, CYP2D6, and SULT1A1 genes.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20596254 A CYP1A1 polymorphism is correlated with pterygium and might become a marker for the prediction of pterygium susceptibility.
20596254 Observational study of gene-disease association. (HuGE Navigator)
20584197 There is no relation between the occurrence of the CYP1A1 MspI and Ile(462)Val single nucleotide polymorphisms and the risk of developing hidradenitis suppurativa.
20584197 Observational study of gene-disease association. (HuGE Navigator)
20579990 In a case-control study, we were unable to demonstrate any association between MSP I CYP1A1 polymorphism and the risk of leiomyoma in Brazilian women.
20579990 Observational study of gene-disease association. (HuGE Navigator)
20559649 We concluded that the carriage of CYP1A1 Ile462Val AG and CYP1B1 Leu 432Val CC genotypes predict the susceptibility to leiomyoma in Egyptian women and they are likely to contribute in the pathogenesis of leiomyoma
20559649 Observational study of gene-disease association. (HuGE Navigator)
20554493 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20544687 Observational study of gene-disease association. (HuGE Navigator)
20534171 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20529763 Observational study of gene-disease association. (HuGE Navigator)
20511665 Observational study of gene-disease association. (HuGE Navigator)
20491576 GSTM1 copy number variations and CYP1A1 polymorphisms individually as well in interaction with tobacco consumption may increase the risk of head and neck cancer.
20491576 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20462615 In utero tobacco exposure significantly increases placental CYP1A1 expression in association with differential methylation at a critical xenobiotic response element.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20437850 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20428802 Meta-analysis of gene-disease association. (HuGE Navigator)
20381444 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20377136 The CYP1A1 Ile462Val polymorphism is associated with platinum resistance of epithelial ovarian neoplasms.
20377136 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20375710 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20373852 Observational study of gene-disease association. (HuGE Navigator)
20345875 Single nucleotide polymorphisms in the hormone-metabolizing gene CYP1A1 are related to the risk of developing both seminomatous and non-seminomatous testicular cancer and may contribute to variability of individual susceptibility to testicular cancer.
20345875 Observational study of gene-disease association. (HuGE Navigator)
20297661 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20226777 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20214802 Observational study of gene-disease association. (HuGE Navigator)
20193595 CYP1A1 gene polymorphism Ile/Val might have played a role in the development of esophageal squamous-cell carcinoma, but CYP1A1 MspI polymorphism might not be associated with the susceptibility of esophageal cancer.
20193595 Meta-analysis of gene-disease association. (HuGE Navigator)
20177288 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20136364 Observational study of genetic testing. (HuGE Navigator)
20131310 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20095411 Genetic peculiarities particularly xenobiotic detoxification enzymes CYP1A1, CYP2E1, EPHX1 and GSTM1, GSTT1 play important role in pulmonary diseases development.
20095411 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20094781 inherent estrogen metabolism as determined by C4887A polymorphisms is not associated with colorectal neoplasm risk
20094781 Observational study of gene-disease association. (HuGE Navigator)
20088394 CYP1A1 polymorphisms probably predispose to an earlier onset of breast cancer and might be associated with higher c-erbB-2 protein level, but further studies on a much larger group are required to substantiate our findings.
20088394 Observational study of gene-disease association. (HuGE Navigator)
20088379 Observational study of gene-disease association. (HuGE Navigator)
20080081 The patients were over-represented by the alleles 462Val, 3801C of CYP1A1. CYP1A1 haplotype, 462Val:3860G and 462Val:3801T:3860G were significantly over-represented.
20080081 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20054510 We conclude that in this sample of the Portuguese population, CYP1A1 m1 and m2 polymorphisms are too rare to be of clinical relevance, and do not seem to be associated with susceptibility to lung cancer
20054510 Observational study of gene-disease association. (HuGE Navigator)
20052535 This meta-analysis provides strong evidence that CYP1A1 T3801C polymorphism is not associated with breast cancer risk.
20052535 Meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
20047124 there was no evidence of any influence by genetic polymorphisms of NAT2, CYP1A1, and CYP1A2 on the risk of stomach cancer
20047124 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20035380 Meta-analysis: CYP1A1 A2455G G allele is a risk factor for breast cancer among Caucasian subjects. T3801C, T3205C, and C2453A status does not seem capable of modifying breast cancer risk.
20035380 Meta-analysis of gene-disease association. (HuGE Navigator)
20032816 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20029944 Observational study of gene-disease association. (HuGE Navigator)
20027111 Meta-analysis of gene-disease association. (HuGE Navigator)
20012094 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20009880 CYP1A1 gene polymorphisms are not associated with cervical cancer.
20009880 Observational study of gene-disease association. (HuGE Navigator)
19995559 The study delineates the correlation between CYP1A1-mediated oxidative stress and NFkappaB signaling that leads to the development of breast cancer.
19963139 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19963114 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19954069 There was no statistical significance between CYP1A1 m1 polymorphism and susceptibility of nasopharyngeal carcinoma in Cantonese nuclear families.
19954069 Observational study of gene-disease association. (HuGE Navigator)
19954068 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19947517 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19903800 Observational study of gene-disease association. (HuGE Navigator)
19899130 The CYP1A1 rs1048943 genotype affectS the risk of non-Hodgkin's lymphoma in Korea.
19899130 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19892789 The frequencies of phase I wild-type genotypes of CYP1A1 and CYP2D6 in recurrent miscarriage cases were 0.56 and 0.60, whereas in controls these were 0.68 and 0.65, respectively.
19892789 Observational study of gene-disease association. (HuGE Navigator)
19863350 Observational study of gene-disease association. (HuGE Navigator)
19860743 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19827888 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19826048 Observational study of gene-disease association. (HuGE Navigator)
19822571 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19799358 Observational study of gene-disease association. (HuGE Navigator)
19797843 Certain maternal genetic polymorphisms in the polycyclic aromatic hydrocarbons (PAHs)-metabolizing enzymes have been shown to enhance the association between maternal smoking and infant birth weight in both Caucasians and Japanese.
19789301 UV radiation exposure induced CYP1A1 and CYP1B1 in HaCaT cells
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19786002 CC genotype of CYP1A1 is associated in the pathogenesis of male infertility
19776291 Observational study of gene-disease association. (HuGE Navigator)
19751749 Observational study of gene-disease association. (HuGE Navigator)
19750329 The CYP1A1*2A gene cannot be linked with lung cancer risk in Brazilian patients at this time.
19750329 Observational study of gene-disease association. (HuGE Navigator)
19718946 CYP1A1 genotype m2 allele was not found to be associated with the risk of developing leukoplakias in the population.
19718946 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19682433 ER8 motif is highly conserved in the CYP1A1 proximal promoter sequences of various species, suggesting a fundamental role of CAR in the xenobiotic-induced expression of CYP1A1 and CYP1A2 independent of aryl hydrocarbon receptor
19679043 Observational study of gene-disease association. (HuGE Navigator)
19666078 Suggest that CYP1 family enzymes enhance the antiproliferative activity of dietary flavonoids in breast cancer cells, through bioconversion to more active products.
19650794 The results indicate that the homozygous CYP1A1 6235C genotype is associated with greater mortality following the onset of acute coronary syndromes, independent of ethnicity and clinical risk factors, but related to smoking history.
19650794 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19643819 CYP1A2 -3860G>A polymorphism modifies the smoking-related hepatocellular carcinoma risk among chronic liver disease Japanese.
19643819 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19639480 Polymorphism in cytochrome P4501A1 is significantly associated with head and neck cancer risk.
19639480 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19632247 Our data thus provides evidence of CYP1A1 expression in freshly isolated blood lymphocytes and differences in reactivity in individuals with variant genotypes of CYP1A1
19632247 Observational study of gene-disease association. (HuGE Navigator)
19630952 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19627379 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19608585 The present study has identified risk haplotypes for CYP1A1 in NSCLC and confirmed that CYP1A1 polymorphisms are a minor risk factor for NSCLC
19608585 Observational study of gene-disease association. (HuGE Navigator)
19598235 Observational study of gene-disease association. (HuGE Navigator)
19582785 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19576320 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19575027 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19574343 Observational study of gene-disease association. (HuGE Navigator)
19563927 Our findings suggest that the CYP1A1 2C G/G genotype may reduce the risk for CAD in the Taiwanese population and this effect appeared to be more pronounced among never smokers.
19563927 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19561157 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19538838 Coke oven workers with Val/Val genotype in exon 7 of CYP1A1 had significantly higher urinary 1-hydroxypyrene levels than those with Ile/Val or Ile/Ile genotype.
19538838 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19537956 association of the CPY1A1-m1 variant with a reduced response to HAART therapy in HIV infected smokers is consistent with this enzyme's role in metabolic conversion of environmental toxins to DNA adducts, which may directly promote HIV-1 gene expression
19537956 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19526463 posttranslational mechanism involving decreases in the cellular heme pool by arsenite-induced HO-1 may contribute to arsenite-mediated downregulation of CYP1A1.
19521675 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19507064 no association between CYP1A1 Ile462Val genotypes and metabolic parameters was observed in Chinese polycystic ovary syndrome women
19507064 Observational study of gene-disease association. (HuGE Navigator)
19507017 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19505920 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19479063 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19472123 CYP1A1 polymorphism is likely to increase the the risk of prostate cancer development in large population.
19472123 Meta-analysis of gene-disease association. (HuGE Navigator)
19469619 Genetic polymorphisms of GSTM1, GSTT1 and CYP1A1 may not be risk factors for oral cancer in the Jakarta population.
19469619 Observational study of gene-disease association. (HuGE Navigator)
19456854 analysis of acute myeloid leukaemia in individuals with cytochrome P450 A1 (CYP1A1) and NAD(P)H:quinone oxidoreductase 1 (NQO1) gene defects
19453261 Observational study of gene-disease association. (HuGE Navigator)
19452301 no association was found between HCA intake and colorectal cancer, or any evidence of influence by genetic polymorphisms of NAT2, CYP1A1, and CYP1A2.
19443378 No statistically significant effects on bladder cancer risk with CYP1A1, CYP1B1 and COMT genotypes were observed
19427967 Results suggest that CYP1A1 exon7 polymorphisms may be a risk factor for esophageal cancer in Asians but not in Caucasians, whereas neither CYP1A1 Msp1 nor GSTM1 polymorphism was associated with increased susceptibility to esophageal cancer.
19427967 Observational study of gene-disease association. (HuGE Navigator)
19424794 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19424633 Anticancer effects of the flavonoid diosmetin on cell cycle progression and proliferation of MDA-MB 468 breast cancer cells due to CYP1A1 activation.
19415745 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19414505 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19412423 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19387820 Observational study of gene-disease association. (HuGE Navigator)
19356113 The metabolism and biotransformation of the (14)C-labeled phenylurea herbicide fluometuron was examined using tobacco cell suspension cultures transformed separately with human cyp1a1
19351467 The gene polymorphisms of CYP2E1, CYP1A1, IL-4 are probably associated with susceptibility for trichloroethylene-induced medicamentosa-like dermatitis.
19351467 Observational study of gene-disease association. (HuGE Navigator)
19346634 our results suggest a significant correlation between CYP1A1*2 expression and the occurrence of breast cancer.
19346634 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19339270 Observational study of gene-disease association. (HuGE Navigator)
19338043 An increased risk of DLBCL in nonsmokers was associated with the variant G allele for CYP1A1 (OR = 2.4; 95% CI 1.0-5.7)
19338043 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19336370 Observational study of gene-disease association. (HuGE Navigator)
19317600 The researchers found evidence of polymorphisms in the CYP1A1*2C haplotype in a Mexican Mestizo population, which suggests an increased susceptibility to environmenal carcinogens.
19317600 Observational study of genotype prevalence. (HuGE Navigator)
19307236 Observational study of gene-disease association. (HuGE Navigator)
19303595 High DDE-DDT exposure adversely affected sperm parameters and its effects were exacerbated by the GSTT1 null polymorphism and by the CYP1A1 common alleles.
19303595 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19290787 Observational study of genotype prevalence. (HuGE Navigator)
19287966 CpG methylation of the CYP1B1 promoter region, but not CYP1A1, epigenetically regulates CYP1B1 expression during development of some colorectal cancers
19285097 mouse liver CYP1A1-specific enzyme activities are between 38- and 170-fold higher than human CYP1A1-specific enzyme activities (per unit of mRNA), whereas mouse versus human CYP1A2 enzyme activities (per unit of mRNA) are within 2.5-fold of one another.
19276377 Authors use custom genotyping panel containing 50 single nucleotide polymorphisms in the CYP1A1/2 region and 184 ancestry informative markers selected to have large allele frequency differences between Africans, Europeans, and Amerindians.
19276377 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19267064 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19264525 Observational study of genotype prevalence. (HuGE Navigator)
19252926 The data suggest CPY1A1 MspI polymorphism as a risk factor for laryngeal cancer in Caucasians but not in Asians.
19252926 Meta-analysis of gene-disease association. (HuGE Navigator)
19246429 We assessed the association of the Msp I polymorphism in CYP1A1 (*2A) and the null GSTM1 with maternal smoking behavior during pregnancy
19246429 Observational study of gene-disease association. (HuGE Navigator)
19229255 Observational study of gene-disease association. (HuGE Navigator)
19222528 Meta-analysis of gene-disease association. (HuGE Navigator)
19178087 Analysis of the cytochrome P450 (CYP1A1) gene polymorphism in the ethnic groups of the Republic of Bashkortostan
19178087 Observational study of genotype prevalence. (HuGE Navigator)
19174490 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19160101 Meta-analysis of gene-disease association. (HuGE Navigator)
19147266 Smokers with the variant CYP1A1 "aa" genotype had babies with lower mean birthweight than non-smokers with the same genotype (p=0.004).
19147266 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19143007 Although expression of activating and/or detoxifying enzymes (CYP1B1, NAT1, and COMT) may be higher in the peripheral zone of the prostate, PAH-DNA adduct levels appear to be similar in peripheral zone and transition zones.
19138996 Heat shock protein 90 inhibitors suppress aryl hydrocarbon receptor-mediated activation of CYP1A1 and CYP1B1 transcription and DNA adduct formation.
19127255 Observational study and meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
19126602 Expression of CYP1A1 and CYP1B1 in human endothelial cells: regulation by fluid shear stress.
19110417 results suggested that common genetic variants in CYP1A1 may modulate the risk of developing HCC in the study population, particularly in non-smokers.
19074885 Observational study of gene-disease association. (HuGE Navigator)
19070657 CYP1A1 induction and CYP3A4 inhibition by the fungicide imazalil in the human intestinal Caco-2 cells-comparison with other conazole pesticides.
19064581 No association between CYP1A1 polymorphisms and risk for hepatocellular carcinoma.
19064581 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19031960 Observational study of gene-disease association. (HuGE Navigator)
19024313 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19022366 Our results demonstrated an association between the CYP1A1/PON1 polymorphisms and several medical examination findings.
19022366 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
19013013 broccoli-derived SUL can directly induce Cyp1a1 gene expression in an AhR-dependent manner and represents a novel mechanism by which sulforaphane induces this enzyme
19012698 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19009239 CYP1A1 (Val/Val) genotype increases the susceptibility to Lung cancer eightfold along with null genotype of GSTM1/GSTT1
19009239 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18992263 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18990750 Red meat intake was associated with increased colorectal cancer regardless of genotype, but the CYP1A1 combined variant modified association between meat doneness and cancer risk.
18990750 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18990008 Observational study of gene-disease association. (HuGE Navigator)
18980759 Observational study of gene-disease association. (HuGE Navigator)
18979064 the null genotype for the GSTT1 gene and the A/G and G/G variants of the CYP1A1 gene may contribute to the development of bladder cancer.
18979064 Observational study of gene-disease association. (HuGE Navigator)
18941913 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18936436 Observational study of genotype prevalence. (HuGE Navigator)
18849443 suggest an up-regulation of dioxin-inducible CYP1A1 and gamma-SYNUCLEIN occurs in endometriosis
18824009 results strongly suggest that hyperoxia transcriptionally activates CYP1A1 expression in human lung cell lines by AHR-dependent mechanisms, and that CYP1A1 induction is associated with decreased toxicity
18819424 The findings have led to the conclusion that carriage of polymorphic allele Val of exon 7 (A4889G) of the CYP1A1 gene in those infested with E. granulosus genotype G1 is a risk factor of the development of the clinical form of echinococcosis granulosus.
18819424 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18800292 Observational study of gene-disease association. (HuGE Navigator)
18798002 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18784359 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18779756 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18774560 Our results suggest that genetic polymorphisms of xenobiotic-metabolizing enzymes could play an important role in infertility.
18774560 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18768509 The 1462V and Msp1 polymorphisms in CYP1A1 may be an additional susceptibility factor for disease expression in Lynch syndrome because they modify colorectal neoplasm age of onset by 4 years
18768509 Observational study of gene-disease association. (HuGE Navigator)
18767181 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18763031 the genotype of CYP1A1 Ile462Val, but not the CYP1B1 polymorphism, is associated with the increased risk of uterine leiomyomas in Chinese women
18763031 Observational study of gene-disease association. (HuGE Navigator)
18706519 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18700132 CREM has a role in CYP1A1 induction through ligand-independent activation pathway of aryl hydrocarbon receptor in HepG2 cells
18698632 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18691756 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18642288 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18636124 Observational study of gene-disease association. (HuGE Navigator)
18632753 Observational study of gene-disease association. (HuGE Navigator)
18628428 The increased risk of breast cancer associated with E+P use was greater among women with at least one rare allele of the CYP1A1 Ile(462)Val, CYP1A1 MspI, CYP1B1 Asn(453)Ser, and PGR Val(660)Leu polymorphisms.
18628428 Observational study of gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18618215 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18601742 Observational study of gene-disease association. (HuGE Navigator)
18593984 Observational study of gene-disease association. (HuGE Navigator)
18590468 findings corroborate metabolic genes interactions, especially for CYP1A1 462Val alleles and GSTM1 homozygous deletion, in the development of head and neck cancer in the investigated population groups in Poland
18590468 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18589596 CYP1A1 heterozygous mutation and homozygous mutation combined with GSTT1 null genotypes in mothers could increase the risk of preterm delivery.
18589596 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18577398 CYP1A1 Ile462Val can modify the effect of cord blood cotinine on early child neurodevelopment especially for language and fine motor development.
18577398 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18569591 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18550589 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18510611 Observational study of gene-disease association. (HuGE Navigator)
18507060 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18507050 CYP1A1, GSTM1 and GSTT1 polymorphisms do not appear to influence the genetic susceptibility to OSCC or the progression to more advanced stages.
18507050 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18497059 CYP1A1 M1 polymorphism is associated with breast cancer
18497059 Observational study of gene-disease association. (HuGE Navigator)
18496222 GSTM1 homozygous deletion and the CYP1A1 m1m2 variant along with tobacco use play a significant role in oral and pharyngeal cancer
18496222 Meta-analysis of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18495522 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18493746 Pharmacologic profiling of CYP1A1 induction and competition is reported.
18463401 Genetic polymorphisms in CYP1A1 are associated with lung cancer risk in Asian smokers.
18463401 Meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
18449058 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18447907 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18437510 In the passive smoking group, women who have C/C6235 genotype, in CYP1A1 (cytochrome P450 family 1 subfamily A polypeptide 1) MspI and Ile/Ile462 genotype in CYP1A1 HincII was associated with an increased risk of dysmenorrhea
18437510 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18415801 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18415690 in testicular cancer two nonredundant SNPs in CYP1A1 (cytochrome P450 family 1 subfamily A polypeptide) were inversely associated with nonseminoma: CYP1A1 promoter SNP rs4886605 and rs2606345 intron 1 SNP
18415690 Observational study of gene-disease association. (HuGE Navigator)
18414197 Genetic polymorphisms of metabolic enzymes CYP1A1, CYP2D6, GSTM1 and GSTT1 and leukemia susceptibility.
18414197 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18409147 significant association between *2B/*2B and *4/*4 genotypes and the risk of developing lung cancer among Mexicans
18409147 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18409146 incidence of the polymorphism A-->G (Ile462Val, exon 7) in colorectal cancer patients and the correlation of this polymorphism with others risk factors
18409146 Observational study of gene-disease association. (HuGE Navigator)
18389617 Association of cytochrome P450 genes polymorphisms (CYP1A1 and CYP1A2) with the development of chronic obstructive pulmonary disease in Bashkortostan
18389617 Observational study of gene-disease association. (HuGE Navigator)
18351133 The homozygous mutant (G/G) of m2 CYP1A1 gene polymorphism was significantly associated with breast cancer; out of ml and m2 polymorphisms that have been reported in Asians, only m2 is associated with North Indians
18351133 Observational study of gene-disease association. (HuGE Navigator)
18339256 In codon 462 of exon 7, patients with polycystic ovary syndrome had a 7.4-fold higher frequency of any Val genotype (Ile/Val or Val/Val).
18339256 Observational study of gene-disease association. (HuGE Navigator)
18320229 Taken together, maternal smoking significantly increased the risk of preterm delivery (PTD) among women with high-risk CYP1A1 and GSTT1 genotypes. Such joint associations were strongest among PTD accompanied by histologic chorioamnionitis.
18320229 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18318428 a decreased single nucleotide polymorphism of CYP1A1 and an increased single nucleotide polymorphism for SULT1A1 and SULT1E1 genes may be risk factors for endometrial cancer in Caucasians.
18318428 Observational study of gene-disease association. (HuGE Navigator)
18317771 Observational study of gene-disease association. (HuGE Navigator)
18304461 No significant differences in the frequency distributions of CYP1A1 polymorphisms were observed between prostate cancer patients and controls.
18304461 Observational study of gene-disease association. (HuGE Navigator)
18287869 studied the association of polymorphisms of cytochrome P450 (CYP-4501A1*2A, *2B, *2C and *4 alleles, CYP-4502D6*4 allele), GSTM1 and GSTT1 null genotypes, and NAT2*6B and *7A alleles with the incidence of AML in an eastern Indian population
18287869 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18287863 The CC genotype of CYP1A1 was significantly associated with a risk of gallbladder cancer in a north Indian population
18287863 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18285692 Observational study of gene-disease association. (HuGE Navigator)
18268125 PAH-DNA adduct formation could be modulated by common genetic variants in CYP1A1 in African American, Dominican and Caucasian mothers and newborns.
18268125 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18261353 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18247309 MspI and Ile/Val genotypes of CYP1A1 gene were detected. The Ile/Val polymorphism in exon 7 of CYP1A1 may be associated with the susceptibility of ICP while th MspI polymorphism of CYP1A1 is not associated with the risk of ICP in Chengdu.
18247309 Observational study of gene-disease association. (HuGE Navigator)
18241825 Study reports a gene-gene interaction between CYP1A1-I462V and GSTM1 and the risk of preterm delivery in Korean women.
18241825 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18224491 The aim of the present study is to investigate the influence of cytochromes P450 (CYP450) 1A1*2C and Glutathione S-transferases (GSTs) (T1 and M1) gene polymorphisms in susceptibility to chronic myeloid leukaemia (CML).
18224491 Observational study of gene-disease association. (HuGE Navigator)
18203634 data indicate that the CYP1A1*2A genotype contributes significantly to susceptibility to adult acute lymphoblastic leukemia in a sample of the Mexican population
18203634 Observational study of gene-disease association. (HuGE Navigator)
18203021 gene polymorphisms in CYP1A1, GSTT1, GSTP1, GSTM1, and NQO1 were characterized in Saudi individuals with a diagnosis of DLBCL; CYP1A1, GSTT1, GSTP1 demonstrated significant association of DLBCL risk; GSTM1 and NQO1 did not.
18203021 Observational study of gene-disease association. (HuGE Navigator)
18200441 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18180754 No significant pooled odds ratios for contrasting alleles or genotypes could be found for three variants studied with regard to susceptibility to antipsychotic-induced tardive dyskinesia.
18159984 CYP1A1*2A T/C genotype is associated with colorectal cancer in Japanese never-smokers. The combination of NAT2 plus CYP1A1*2A or CYP1A1*2C may indicate genetic susceptibility in never-smokers.
18159984 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18090121 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18090121 Glutathione-S-transferase T1 and M1 and cytochrome P1A1 genetic polymporphisms do not appear to be a risk factor for cervical disease irrespective of smoking habits.
18082227 Cigarette smoking or tobacco chewing or alcohol consumption was also found to interact with CYP1A1 genotypes in increasing the risk to lung cancer.
18082227 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18078203 Observational study of genotype prevalence and gene-gene interaction. (HuGE Navigator)
18078203 The researchers investigated the frequency of the CYP1A1*3 allele in a population of Mestizos in Mexico and found the highest frequencies in any previously studied population.
18074679 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18074679 CYP1A1 genotype did not influence the susceptibility of developing esophageal cancer.
18070799 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18065768 Aryl hydrocarbon receptor mediates laminar fluid shear stress-induced CYP1A1 activation and cell cycle arrest in vascular endothelial cells.
18061941 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17996038 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17982751 RCC risk among smokers might be more increased with the CYP1A1*2C genotype, GSTmicro1 null, or both a CYP1A1 variant and GSTmicro1 null.
17982751 Observational study of gene-environment interaction. (HuGE Navigator)
17981384 CYP1A1 over-expression did not protect against xenobiotic assault.
17980933 CYP1B1, CYP1A1, MPO, and GSTP1 polymorphisms and lung cancer risk in never-smoking Korean women.
17980933 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17980001 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17959138 Although 7-ethoxyresorufin O-deethylation by CYP1A1 and several mutants exhibited substrate inhibition, it is unlikely that inhibition arises from the simultaneous binding of two substrates.
17919675 Benzo(k)fluoranthene and benzo(a)pyrene induced CYP1A1 and CYP1B1 in T-47D human breast cancer cells.
17919073 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17908297 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17900751 we found evidence of an association between the CYP1A1 variant and GSTM1 null genotypes and increased risk of lung cancer.
17900751 Meta-analysis of gene-disease association. (HuGE Navigator)
17896209 Observational study of gene-disease association. (HuGE Navigator)
17873299 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17873299 T6235C CYP1A1 polymorphism is a risk factor for the development of cerebral infarct.
17852022 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17852022 Genetic variations in CYP1A1 and CYP1A2 genes do not seem to influence riluzole levels.
17823232 Used shuffled CYP1A1 library to examine genotype/phenotype of mutant forms.
17786624 the impact of genetic variability of CYP1A1 on cancer susceptibility, effects of polyphenols and hyperforin on toxification and detoxification pathways are presented--REVIEW
17728147 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17728147 CYP1A1MspI and HincII genotypes modified the association between passive smoking and primary dysmenorrhea
17717632 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17711714 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17706398 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17706398 In conclusion, high PM(10) exposure during the 1st trimester increased the risk for reduced BW in concert with MspI TC/CC and NcoI IleVal/ValVal genotypes in Korean women.
17695473 Observational study of gene-disease association. (HuGE Navigator)
17651397 results suggest that the CYP1A1 polymorphisms may contribute to the pathogenesis of male infertility in the Han-Chinese population
17651397 Observational study of gene-disease association. (HuGE Navigator)
17646057 Observational study of gene-disease association. (HuGE Navigator)
17646057 for esophageal and gastric adenocarcinomas, no consistent patterns of elevated risk were associated with CYP1A1 Val/Val or Ile/Val genotypes (versus Ile/Ile).
17642299 Observational study of genetic testing. (HuGE Navigator)
17640999 RL95-2 cells are susceptible to apoptosis by exposure to B[a]P, and B[a]P-evoked apoptosis is mediated predominantly by the activation of CYP1A1.
17630984 We provide evidence that unique P450 enzymes, generated by alternate splicing in a histiospecific manner can modify genotoxic potential of carcinogens such as benzo(a)pyrene by altering their biotransformation pathway.
17623765 Time-dependent differences in CYP1A1 expression in placental cells exposed to TCDD and PCDD/PCDF mixture.
17620151 Observational study of genotype prevalence. (HuGE Navigator)
17620151 For the CYP1A1 gene, a possible new haplotype was observed, even though at a very low frequency, in Tauregs from Libya
17611777 Polymorphisms in CYP1A1 is not associated with the risk of head and neck cancer
17611777 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17610937 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17603290 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17603290 CYP1A1 MspI polymorphisms could affect susceptibility to breast cancer.
17590289 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17589376 Observational study of gene-disease association. (HuGE Navigator)
17588204 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17577786 CYP1A1 polymorphisms modify overall survival in acute myeloid leukemia patients.
17566695 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17566695 Passive smoking and CYP 1A1 genotype were associated with risk for dysmenorrhea.
17549424 study describes novel CYP1A1 splicing variants commonly and frequently transcribed in leucocytes of healthy volunteers, separated from variants exclusively expressed in tumour cell lines
17548691 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17531965 Observational study of gene-disease association. (HuGE Navigator)
17531965 These results suggest that the Val allele of CYP1A1 Ile462Val polymorphism and the Pro allele of TP53 Arg72Pro polymorphism contribute to an increased risk of gallbladder cancer among Japanese women and men, respectively.
17526865 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17526865 The authors conclude that the CYP1A1 MspI and EPHX1 genotypes modified the association between maternal passive smoking and infant birth weight in this study, which is suggestive of possible gene-environment interaction.
17512776 Observational study of gene-disease association. (HuGE Navigator)
17512722 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17512722 These results suggest an important role of the CYP1A1 MspI polymorphism in the risk of developing cervical cancer in Mexican women.
17507624 Observational study of gene-disease association. (HuGE Navigator)
17498780 Observational study of gene-disease association. (HuGE Navigator)
17496311 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17479406 Observational study of gene-disease association. (HuGE Navigator)
17479406 The data suggested that individuals with CYP1A1 c.5639 T/T, CYP2D6 c.188 C/C, C/T, and CYP2D6 c.4268 C/C genotypes tend to be more susceptible to benzene toxicity.
17477782 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17461521 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17461521 Individuals with this genotype are hight susceptibble to oral squamous cell carcinoma and with increased rish in Koreans.
17449539 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17429315 Observational study of gene-disease association. (HuGE Navigator)
17429172 Observational study of gene-disease association. (HuGE Navigator)
17428572 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17428572 Subjects who had the mutant alleles of the GSTP1 and CYP1A1 and homozygous wild type of MPO, showed approximately 5-fold-higher risk for lung cancer than the reference.
17427032 Meta-analysis of gene-disease association. (HuGE Navigator)
17427032 Meta-analysis suggests that an A2455G G/G genotype of CYP1A1 is associated with a trend of reduced breast cancer risk, both in east-Asian women and in pre-menopausal women worldwide, while the T3801C C allele might not be a risk factor for breast cancer.
17412371 Observational study of gene-disease association. (HuGE Navigator)
17408703 Observational study of gene-gene interaction and gene-environment interaction. (HuGE Navigator)
17408703 No significant differences were observed in CYP1A1 genotypes frequencies between CAD and non-CAD smokers.
17403528 Observational study of gene-disease association. (HuGE Navigator)
17372252 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17372243 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17372239 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17367411 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17363580 Observational study of gene-disease association. (HuGE Navigator)
17361553 Observational study of gene-disease association. (HuGE Navigator)
17316563 internal genomic sequences of the human CYP1A1 gene, especially the internal sequence of intron-1, are involved in superinduction of the CYP1A1 gene by cycloheximide.
17311112 Proliferation of breast cancer cells is accompanied not only by expression of genes encoding cytochromes involved in estrogen metabolism, but also by changes in the expression of other genes.
17307803 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17307803 CYP1a1 polymorphism does not independently confer risk to OSCC.
17307802 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17220347 Observational study of gene-disease association. (HuGE Navigator)
17192049 Observational study of gene-disease association. (HuGE Navigator)
17192049 CYPp4501A1 gene variants as susceptibility marker for prostate cancer.
17191090 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17174438 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17171211 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17167268 Observational study of gene-disease association. (HuGE Navigator)
17164366 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17160896 Observational study of gene-disease association. (HuGE Navigator)
17160265 Observational study of gene-disease association. (HuGE Navigator)
17160265 CYP1A1 and GSTP1 polymorphisms have been associated with a higher risk to develop several cancers, including oral squamous cell carcinoma (OSCC), which is closely related to tobacco and alcohol consumption.
17158763 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17119063 Observational study of gene-disease association. (HuGE Navigator)
17118447 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17113562 Observational study of genotype prevalence. (HuGE Navigator)
17083362 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17078101 Observational study of gene-disease association. (HuGE Navigator)
17063266 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17063266 CYP1A1 but not CYP1B1 genetic polymorphisms may have roles in breast cancer risk in a Finnish Caucasian population along with smoking
17053541 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17053541 This study is the first to show an interaction between the CYP1A1 T3801C and AHR G1661A polymorphisms; this interaction could explain the difference in blood pressure level between smokers and non-smokers/ex-smokers
17035385 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17022435 Observational study of gene-disease association. (HuGE Navigator)
16998606 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16985250 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16985033 Observational study of gene-disease association. (HuGE Navigator)
16985026 Observational study of gene-disease association. (HuGE Navigator)
16977255 Observational study of gene-disease association. (HuGE Navigator)
16971197 Observational study of gene-disease association. (HuGE Navigator)
16956909 Observational study of gene-disease association. (HuGE Navigator)
16949388 Observational study of gene-disease association. (HuGE Navigator)
16949388 The urinary levels of estradiola nd estrogen metabolites associated with polymorphisms of CYP1A1 AND CYP1B1 in premenopausal/perimenopausal women are reported.
16947004 Results show for the first time that urothelial cells respond to cigarette smoking by induction of CYP1A1.
16926176 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16914185 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16882880 These results establish the importance of coactivators PGC1alpha and SRC1 for the hepatic expression of human P450s and uncover a new HNF4alpha-dependent regulatory mechanism to constitutively control the CYP1A1/2 cluster.
16864595 Observational study of gene-disease association. (HuGE Navigator)
16837240 Observational study of gene-disease association. (HuGE Navigator)
16835796 Observational study of gene-disease association. (HuGE Navigator)
16834659 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16823842 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16823842 No evidence of interaction between CYP1A1 and smoking and colorectal ccancer
16807674 Observational study of gene-disease association. (HuGE Navigator)
16807674 Results suggest that probably CYP1A1 (M1, M2, M3, and M4) polymorphism alone does not play a significant role in the breast cancer risk in north Indian women.
16803538 Observational study of gene-disease association. (HuGE Navigator)
16792888 CYP1A1 m2 genetic polymorphism was associated with increased risk of female breast cancer while DDT exposure might have increased the risk of breast cancer among premenopausal women with CYP1A1 m2 variant genotype
16792888 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16788090 These findings demonstrate that 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD)-mediated aryl hydrocarbon receptor (AhR) signaling is impaired in hepatocytes in which hepatitis C virus (HCV) is present.
16771603 Observational study of genotype prevalence. (HuGE Navigator)
16767678 Observational study of genotype prevalence. (HuGE Navigator)
16763966 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16721740 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16697254 Observational study of gene-disease association. (HuGE Navigator)
16676594 These results indicated that both the variation of CYP1A1 gene or GSTT1 -/- genotype alone might not be associated with the susceptibility of acute leukemia.
16676594 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16638864 Observational study of gene-disease association. (HuGE Navigator)
16625286 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16625286 Alleles and smoking play a significant role in modified prostate cancer risk in this study population.
16620591 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16614120 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16614107 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16608396 Observational study of gene-disease association. (HuGE Navigator)
16599372 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16598069 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16580705 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16527884 Observational study of gene-disease association. (HuGE Navigator)
16527884 COMT, but not CYP1A1 or CYP17, appears to have roles in adenomyosis and endometriosis
16505155 Induction of human CYP1A1 and CYP1A2 is simultaneously controlled through bidirectional and common regulatory elements.
16493615 Observational study of gene-disease association. (HuGE Navigator)
16492926 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16492926 Risk of breast cancer was doubled for genotypes CYP1A1 MspI m1/m2 and CYP1A1 MspI m2/m2. There seems to be a joint effect on breast cancer risk between genotypes CYP1A1 MspI and ERalpha XbaI, CYP1A1 MspI and ERalpha PvuII, and among all three genotypes.
16488179 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16484137 Observational study of gene-disease association. (HuGE Navigator)
16481407 Maternal smoking in combination with maternal CYP1A1 genetic polymorphisms may adversely affect infant birth size.
16481407 Observational study of gene-disease association. (HuGE Navigator)
16471212 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16466991 Observational study of gene-disease association. (HuGE Navigator)
16426572 CYP1A1 and CYP1A2 induction by TCDD is differentially regulated in primary human hepatocytes versus transformed human cells
16424825 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16416283 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16416283 Concerted role of CYP1A1 and GSTM1 at-risk genotypes in squamous cell lung carcinoma predisposition.
16414014 present study shows that UMR-106 expresses the AhR and that the expression of CYP1A1 is induced after exposure to TCDD, while down-regulation of OPN is an even more rapid response and a sensitive biomarker to TCDD exposure in this osteoblastic cell line.
16407087 Observational study of gene-disease association. (HuGE Navigator)
16403567 Observational study of gene-disease association. (HuGE Navigator)
16402549 Transgenic enzyme metabolizes 4-n-nonylphenol in tobacco cultures.
16402077 Observational study of gene-disease association. (HuGE Navigator)
16393248 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16360200 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16357600 Meta-analysis and HuGE review of genotype prevalence, gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16357593 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16337337 Observational study of gene-disease association. (HuGE Navigator)
16319265 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16318816 Observational study of gene-disease association. (HuGE Navigator)
16284498 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16284375 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16273625 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16270381 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16260521 Observational study of gene-disease association. (HuGE Navigator)
16254684 Observational study of gene-disease association. (HuGE Navigator)
16235998 Observational study of genetic testing. (HuGE Navigator)
16228113 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16228113 Our study suggests the importance of combined CYP1A1, GSTM1 and GSTT1 polymorphisms in the development of smoking-induced lung cancer.
16227674 Observational study of gene-disease association. (HuGE Navigator)
16227674 Altered metabolism of benzo(a)pyrene due to the polymorphism in the CYP1A1 gene might be an etiologic factor in the increased incidence of aplastic anemia.
16202920 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16153604 The Ile462Val polymorphism in human CYP1A1 affects eicosapentaenoic acid metabolism.
16142442 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16142442 No association found between CYP1A1 polymorphism and breast cancer in older white women
16130011 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16103451 Observational study of gene-disease association. (HuGE Navigator)
16099114 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16084889 Observational study of gene-disease association. (HuGE Navigator)
16051642 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16043197 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16037119 Observational study of gene-disease association. (HuGE Navigator)
16012082 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16012082 MspI polymorphism of CYP450 1A1 was investigated in lung cancer patients and in healthy volunteers in a population eposed to arsenic in drinking water.
16009381 Observational study of gene-disease association. (HuGE Navigator)
16009381 Role of the metabolic gene polymorphisms in non-smoker lung cancer patients from the International Collaborative Study on Genetic Susceptibility to Environmental Carcinogens.
15991278 Observational study of gene-disease association. (HuGE Navigator)
15986113 Observational study of gene-disease association. (HuGE Navigator)
15986113 These new data establish an association between the CYP1A1 Ile462Val polymorphism and the risk of developing non-small cell lung cancer, especially among women
15981231 Observational study of gene-disease association. (HuGE Navigator)
15953982 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15953982 CYP1A1 is a suscpetibility gene for lung cancer among non-smoking Asian women and this asscociation can be influenced by environmental tobacco smoke exposure.
15952134 The CYP1A1 genotype frequencies in Koreans for types of m1/m1, m1/m2, and m2/m2 are 39.7%, 49.7%, and 10.7% respectively, with the allele frequencies 0.645 for m1 and 0.355 for m2, and the gene distribution matched the equilibrium law of Hardy-Weinberg.
15941966 Observational study of gene-disease association. (HuGE Navigator)
15938845 Observational study of gene-disease association. (HuGE Navigator)
15931768 Observational study of genotype prevalence. (HuGE Navigator)
15928955 Observational study of gene-disease association. (HuGE Navigator)
15920291 Observational study of genotype prevalence. (HuGE Navigator)
15914277 Observational study of gene-disease association. (HuGE Navigator)
15914211 Observational study of gene-disease association. (HuGE Navigator)
15870154 Meta-analysis and HuGE review of genotype prevalence, gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
15870154 In 17 studies, no consistent association between breast cancer and CYP1A1 genotype was found.
15861041 Observational study of gene-disease association. (HuGE Navigator)
15861041 there is an association between endometriosis and the GSTM1 null deletion, but not with GSTT1 null deletions or the CYP1A1 MspI polymorphism in South Indian women
15856430 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15856430 Homozygosity in the CYP1A1 gene may be associated with a reduced risk for breast carcinoma, particularly among lean women with long-term endogenous estrogen exposure
15849806 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
15849806 A significant association exists between the CYP1A1 Ile-Val polymorphism and risk of esophageal cancer.
15801491 Observational study of gene-disease association. (HuGE Navigator)
15774926 Observational study of gene-disease association. (HuGE Navigator)
15774541 Observational study of gene-disease association. (HuGE Navigator)
15769360 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15765281 Observational study of gene-disease association. (HuGE Navigator)
15764294 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15756908 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15734958 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15734083 Observational study of gene-disease association. (HuGE Navigator)
15731166 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15731166 The joint carriage of CYP1A1 Val(462) and NQO1 Ser(187) alleles, particularly in smokers, was related to colorectal adenoma risk, with a propensity for formation of multiple lesions
15725614 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15712341 Observational study of gene-disease association. (HuGE Navigator)
15671210 Observational study of genotype prevalence, gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15671210 Risk for colorectal cancer and selected red and white meat mutagen indices and the use of white meat drippings, or fried white meat variables was more evident within select combinations of the CYP1A1 genotype.
15653213 Observational study of gene-disease association. (HuGE Navigator)
15653213 differences in the metabolic activity of Cytochrome P4501A1 (CYP1A1) could play a significant role in the pathogenesis of genital cancers
15648054 Observational study of genotype prevalence. (HuGE Navigator)
15647817 Observational study of gene-disease association. (HuGE Navigator)
15647817 the C4887A polymorphism of the CYP1A1 gene has an effect on the rate of estrogen catabolism and may represent a possible genetic risk factor for osteoporosis
15646021 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15643613 Determination of SNP frequencies in the CYP1A1_CYP1A2 locus.
15642161 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15640066 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15605089 Observational study of gene-disease association. (HuGE Navigator)
15596250 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15591802 Observational study of gene-disease association. (HuGE Navigator)
15583370 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15579657 Observational study of gene-disease association. (HuGE Navigator)
15579657 Association was shown between the genetic polymorphism in CYP1A1 and the risk for hypospadias.
15552037 Observational study of genotype prevalence and genetic testing. (HuGE Navigator)
15547760 CYP1A1 is expressed at relatively early stage of gastrocarcinogenesis
15528152 Observational study of gene-disease association. (HuGE Navigator)
15526353 Observational study of gene-disease association. (HuGE Navigator)
15526353 GSTM1*2/*2 and CYP1A1*1A/*2C genotype frequencies were higher among squamous cell carcinomas at a level close to statistical significance
15521013 new cytochrome P450 1A1 induction pathway involving peroxisome proliferator-activated receptor-alpha and 2 peroxisome proliferator response element sites.
15496536 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15491310 Observational study of gene-disease association. (HuGE Navigator)
15491310 polymorphisms may play an important role in risk for periodontitis
15478298 Observational study of gene-gene interaction and gene-environment interaction. (HuGE Navigator)
15459023 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15386428 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15382273 Observational study of gene-disease association. (HuGE Navigator)
15382051 Observational study of gene-disease association. (HuGE Navigator)
15381379 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15381379 data suggest that the CYP1A1 gene polymorphism may be associated with prostate cancer susceptibility in Turkish men
15376230 Observational study of genotype prevalence. (HuGE Navigator)
15376230 The present study corroborates the high frequencies of*Val and *m2 alleles in the Amerindian populations and detects some differences between Mexican populations that correlate with linguistic differences
15375499 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15363546 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15355699 Observational study of gene-disease association. (HuGE Navigator)
15352038 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15341023 Observational study of gene-disease association. (HuGE Navigator)
15333597 Observational study of gene-disease association. (HuGE Navigator)
15333597 the occurrence of the CYP1A1*2A allele as a probable risk factor in idiopathic recurrent miscarriages
15333250 Observational study of gene-disease association. (HuGE Navigator)
15333250 the hyperinducible CYP1A1 (T6235C) mutant genotype and its mutants in combination with GSTM1 and GSTT1 null genotypes might represent a risk factor for polycystic ovaries
15327835 Observational study of gene-disease association. (HuGE Navigator)
15299091 Observational study of gene-disease association. (HuGE Navigator)
15298960 Observational study of gene-disease association. (HuGE Navigator)
15298960 The risk of childhood leukemia showed no evidence of association between cytochrome P-450 1A1 genotype frequencys and case control status.
15298956 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15279831 Observational study of gene-disease association. (HuGE Navigator)
15241822 Observational study of gene-disease association. (HuGE Navigator)
15241822 CYP1A1-1 (P = 0.004) and CYP1A1-2 (P = 0.03) were found to be associated with significantly decreased and increased risks of breast carcinoma, respectively.
15217514 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15215328 Observational study of gene-disease association. (HuGE Navigator)
15215328 polymorphism and susceptibility to cirrhosis or pancreatitis in alcoholics
15206494 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15195126 Observational study of gene-disease association. (HuGE Navigator)
15194533 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15194533 Polymorphic variants in xenobiotic-metabolism genes including CYP1A1 and GSTT1 may increase the risk of adult AML, particularly when present together.
15185560 Observational study of gene-disease association. (HuGE Navigator)
15184245 Observational study of gene-disease association. (HuGE Navigator)
15184245 In smokers the variant CYP1A1 genotype may confer an increased risk for squamous cell carcinoma.
15180167 Observational study of gene-disease association. (HuGE Navigator)
15177667 Observational study of genotype prevalence. (HuGE Navigator)
15176217 Observational study of gene-disease association. (HuGE Navigator)
15152552 CYP1A1 genotype is associated with enhances sensitivity to environmental factors
15136237 Observational study of gene-disease association. (HuGE Navigator)
15127559 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15127181 Observational study of genotype prevalence. (HuGE Navigator)
15124938 Observational study of gene-disease association. (HuGE Navigator)
15124938 CYP1A1 polymorphism is associated with the susceptibility to psoriatic arthritis in taiwan.
15111988 Observational study of genotype prevalence. (HuGE Navigator)
15093273 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15088300 Observational study of gene-disease association. (HuGE Navigator)
15088300 Simultaneous presence of CYP1A1 4889G and 4887A is associated with development of Behcet's disease in Taiwan.
15069692 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15064998 Observational study of gene-disease association. (HuGE Navigator)
15061915 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15059326 Observational study of gene-disease association. (HuGE Navigator)
15052670 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15052670 CYP1A1 Val/Val and GSTM1 deletion genotypes are genetic susceptibility biomarkers for esophageal cancer.
15037607 CYP1A1 is regulated in a developmental and tissue-specific fashion
15013696 Observational study of genotype prevalence. (HuGE Navigator)
15013696 An analysis was made of CYP1A1 exon 7 polymorphisms by PCR-SSCP in a Brazilian population.
14991750 Observational study of gene-disease association. (HuGE Navigator)
14758730 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14758730 no differences between the patient and control groups regarding genetic polymorphism of genes for non-small cell lung carcinoma
14734460 Observational study of gene-disease association. (HuGE Navigator)
14734460 Single Nucleotide Polymorphisms of CYP1A1 is associated with breast cancer
14724908 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
14719475 Observational study of gene-disease association. (HuGE Navigator)
14695173 The association of tobacco smoking with CYP1A1 methylation in the lung suggests that promoter methylation is involved in the regulation of CYP1A1 induction in vivo.
14693745 Meta-analysis of gene-disease association and gene-gene interaction. (HuGE Navigator)
14693745 CYP1A1 gene polymorphism support modest association with the risk of head and neck neoplasms.
14687717 Observational study of gene-disease association. (HuGE Navigator)
14687717 CYP1A1 4887A may be a risk factor for the development of reactive arthritis, especially in the presence of Mn SOD 1183T/T
14675315 Observational study of gene-disease association. (HuGE Navigator)
14665706 Observational study of gene-disease association. (HuGE Navigator)
14656945 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14646291 Observational study of gene-disease association. (HuGE Navigator)
14639127 Observational study of gene-disease association. (HuGE Navigator)
14634838 Observational study of genotype prevalence. (HuGE Navigator)
14611903 Observational study of gene-disease association. (HuGE Navigator)
14611903 To investigate the role of cytochrome P450 1A1 (CYP1A1) in the pathogenesis of systemic lupus erythematosus (SLE).
14602525 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
14602139 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14582397 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14560034 Results describe the recruitment of aryl hydrocarbon receptor and associated proteins to the human cytochrome P4501A1 gene promoter in vivo.
14534704 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
14534704 specific genotype combinations of CYP1A1, GSTM1 and GSTT1 alleles in the development of lung cancer in heavy smokers
14510941 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12949934 Observational study of gene-disease association. (HuGE Navigator)
12949934 Chilean people carrying single or combined GSTM1 and CYP1A1 polymorphisms are more susceptible to prostate cancer.
12934333 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12925969 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12919721 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12919721 no influence of the genetic polymorphism of cytochrome P450 1A1 on the urinary levels of 1-hydroxypyrene was observed in this study
12903034 Data show that the mutation allele of CYP1A1 gene appears to increase the risk of endometriosis
12903034 Observational study of gene-disease association. (HuGE Navigator)
12883749 Observational study of gene-disease association. (HuGE Navigator)
12880680 Observational study of gene-disease association. (HuGE Navigator)
12880680 The genotype frequency of CYP1A1 4887C/A was significantly lower in patients with ankylosing spondylitis than in controls.
12879168 Observational study of genotype prevalence. (HuGE Navigator)
12854128 Observational study of gene-disease association. (HuGE Navigator)
12854128 CYP1A1 3' polymorphism may be one of the promising protective factors and its wild gene type may be an indicator for higher susceptibility to esophageal cancer.
12846365 Meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
12845676 Observational study of gene-disease association. (HuGE Navigator)
12845676 Single nucleotide Polymorphisms in the CYP1A1 gene are associated with prostate cancer risk
12827651 Observational study of gene-disease association. (HuGE Navigator)
12827651 There are no associations between the genotypes and the risk of developing acute leukemia.
12824892 Observational study of gene-disease association. (HuGE Navigator)
12777964 Observational study of gene-disease association. (HuGE Navigator)
12772461 Observational study of gene-environment interaction. (HuGE Navigator)
12771031 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12767526 Observational study of gene-disease association. (HuGE Navigator)
12767509 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12760253 Observational study of gene-disease association. (HuGE Navigator)
12760253 Polymorphism of CYP1A1 encoding phase 1 xenobiotic detoxication enzyme was studied.
12748560 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12746631 Observational study of gene-disease association. (HuGE Navigator)
12738724 Down-regulation of cytochrome P450 CYP1A1 is associated with breast cancer
12732844 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12729704 Observational study of gene-environment interaction. (HuGE Navigator)
12718576 Observational study of genotype prevalence. (HuGE Navigator)
12713578 Observational study of gene-disease association. (HuGE Navigator)
12713578 The rarer variant alleles protect from psoriasis
12690010 Observational study of gene-disease association. (HuGE Navigator)
12680328 Observational study of gene-disease association. (HuGE Navigator)
12670526 Observational study of gene-disease association. (HuGE Navigator)
12646505 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12631667 Observational study of gene-disease association. (HuGE Navigator)
12620480 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12602902 Observational study of gene-disease association. (HuGE Navigator)
12594823 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12594823 CYP1A1 T3801 C polymorphism and lung cancer: a pooled analysis of 2451 cases and 3358 controls.
12590982 Observational study of gene-disease association. (HuGE Navigator)
12579334 Observational study of gene-disease association. (HuGE Navigator)
12574216 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12569554 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12548461 Observational study of gene-disease association. (HuGE Navigator)
12527337 Effect of genotype on steady-state CYP1A1 gene expression in human peripheral lymphocytes.
12496044 An individual's susceptibility to the effects of PBCs may be partially determined by polymorphism in the gene encoding the biotransformation enzyme cytochrome P450 1A1.
12484238 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12468438 Observational study of gene-disease association. (HuGE Navigator)
12464257 analysis of metabolic pathways involving CYP1A1 and dioxins, and comparison to the rat homolog
12435115 Observational study of genotype prevalence. (HuGE Navigator)
12419832 Observational study of gene-disease association. (HuGE Navigator)
12397416 Observational study of gene-disease association. (HuGE Navigator)
12378791 Observational study of genotype prevalence. (HuGE Navigator)
12365037 Observational study of genotype prevalence. (HuGE Navigator)
12297440 Observational study of gene-disease association. (HuGE Navigator)
12269988 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12269988 individuals with exon 7 containing G allele were at increased risk for oral squamous cell carcinoma and oral precancerous lesion
12237110 Data show that 3-methylcholanthrene and fetal bovine serum cotreatment potentiated CYP1A1 expression, and this potentiation was at least in part associated with an increase in CYP1A1 mRNA and gene transcription levels.
12210751 Differentiation-dependent induction of CYP1A1 in cultured rat small intestinal epithelial cells, colonocytes, and human colon carcinoma cells: basement membrane-mediated apoptosis
12210502 Relationship between CYP1A1 polymorphism and susceptibility to colon cancer
12189551 Observational study of gene-disease association. (HuGE Navigator)
12189551 an exon 7 polymorphism, not a MspI polymorphism, in CYP1A1 may be pivotal in the development of oesophageal cancer in Taiwan.
12183419 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12175533 Observational study of gene-disease association. (HuGE Navigator)
12171760 Observational study of gene-disease association. (HuGE Navigator)
12170467 Observational study of genotype prevalence. (HuGE Navigator)
12163326 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12147246 characterization of human CYP1A1/1A2 induction by DNA microarray and alpha-naphthoflavone
12144816 Observational study of gene-disease association. (HuGE Navigator)
12139735 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12110344 Observational study of gene-disease association. (HuGE Navigator)
12100112 Observational study of gene-disease association. (HuGE Navigator)
12071517 Observational study of gene-disease association. (HuGE Navigator)
12071517 polymorphisms in cyp1a1 is associated with risk of gall bladder cancer
12063626 Observational study of gene-disease association. (HuGE Navigator)
12036913 Observational study of gene-disease association. (HuGE Navigator)
12034316 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12030651 Observational study of genotype prevalence. (HuGE Navigator)
12018173 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11996959 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11996959 The presence of the rare C allele of the CYP1A1 gene in smokers may enhance predisposition to severe coronary artery disease and type 2 diabetes.
11967624 Observational study of gene-disease association. (HuGE Navigator)
11955671 airborne particulates generated during the frying of beef, fish and pork can induce carcinogen-metabolizing CYP1A1 in the human lung-derived cell line
11952781 role in epoxidation of benzo[a]pyrene-7,8-dihydrodiol
11934439 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11895912 Observational study of gene-disease association. (HuGE Navigator)
11872636 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
11872636 we investigated the relationship between the levels of aromatic DNA adducts in breast tissues and polymorphisms of the drug-metabolizing genes CYP1A1, NAT2, and GSTM1 in 166 women having breast cancer
11860900 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11860825 Observational study of gene-disease association. (HuGE Navigator)
11859435 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11854392 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11833070 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11798822 Observational study of gene-disease association. (HuGE Navigator)
11793160 Observational study of gene-disease association. (HuGE Navigator)
11793160 Lack of association between CYP1A1 polymorphism and Parkinson's disease in a Chinese population.
11779261 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11752233 Likewise, DNA damage (SB and DNA adducts) was elevated in V79 h1A1-MZ cells expressing human CYP1A1 when treated with BaP (0.1-0.5 microM) and this was inhibited by chrysin and apigenin, but not by quercetin.
11751440 Observational study of genotype prevalence. (HuGE Navigator)
11719088 Observational study of gene-disease association. (HuGE Navigator)
11698341 Observational study of genotype prevalence, gene-disease association, and gene-environment interaction. (HuGE Navigator)
11689007 aryl hydrocarbon receptor polymorphisms result in lack of CYP1A1 induction
11675474 Observational study of gene-disease association. (HuGE Navigator)
11675150 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11641039 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11641039 CYP1A1 activity might be related to the metabolism of 1-hydroxypyrene and 2-naphthol.
11564581 Observational study of genotype prevalence, gene-disease association, and gene-gene interaction. (HuGE Navigator)
11551408 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11535253 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11525595 Observational study of gene-disease association. (HuGE Navigator)
11520401 Observational study of gene-disease association. (HuGE Navigator)
11511301 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11507974 Observational study of genotype prevalence. (HuGE Navigator)
11503278 Observational study of gene-disease association. (HuGE Navigator)
11501853 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11500195 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
11488937 Observational study of gene-disease association. (HuGE Navigator)
11487538 Meta-analysis of gene-disease association. (HuGE Navigator)
11484167 Observational study of gene-disease association. (HuGE Navigator)
11471167 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11470996 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11470992 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11470760 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11459424 Observational study of genotype prevalence. (HuGE Navigator)
11436564 Observational study of gene-disease association. (HuGE Navigator)
11434510 Observational study of gene-disease association. (HuGE Navigator)
11422615 Observational study of gene-disease association. (HuGE Navigator)
11418090 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11410321 Observational study of gene-disease association. (HuGE Navigator)
11408954 Observational study of gene-disease association. (HuGE Navigator)
11408349 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
11406608 Observational study of gene-disease association. (HuGE Navigator)
11406420 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11396202 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11393538 Observational study of gene-disease association. (HuGE Navigator)
11389067 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11330960 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11325850 Observational study of gene-disease association. (HuGE Navigator)
11295132 Observational study of gene-disease association. (HuGE Navigator)
11291049 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11279306 Observational study of gene-disease association. (HuGE Navigator)
11275366 Observational study of gene-disease association. (HuGE Navigator)
11259393 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11246217 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11236859 Observational study of genotype prevalence. (HuGE Navigator)
11191882 Observational study of genotype prevalence. (HuGE Navigator)
11172643 Observational study of gene-disease association. (HuGE Navigator)
11162685 Observational study of gene-disease association. (HuGE Navigator)
11159735 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11124296 Observational study of gene-disease association. (HuGE Navigator)
11052546 Observational study of gene-gene interaction and gene-environment interaction. (HuGE Navigator)
11045797 Observational study of gene-environment interaction. (HuGE Navigator)
11037803 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11037802 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)

AA Sequence

MLFPISMSATEFLLASVIFCLVFWVIRASRPQVPKGLKNPPGPWGWPLIGHMLTLGKNPHLALSRMSQQY      1 - 70
GDVLQIRIGSTPVVVLSGLDTIRQALVRQGDDFKGRPDLYTFTLISNGQSMSFSPDSGPVWAARRRLAQN     71 - 140
GLKSFSIASDPASSTSCYLEEHVSKEAEVLISTLQELMAGPGHFNPYRYVVVSVTNVICAICFGRRYDHN    141 - 210
HQELLSLVNLNNNFGEVVGSGNPADFIPILRYLPNPSLNAFKDLNEKFYSFMQKMVKEHYKTFEKGHIRD    211 - 280
ITDSLIEHCQEKQLDENANVQLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV    281 - 350
IGRSRRPRLSDRSHLPYMEAFILETFRHSSFVPFTIPHSTTRDTSLKGFYIPKGRCVFVNQWQINHDQKL    351 - 420
WVNPSEFLPERFLTPDGAIDKVLSEKVIIFGMGKRKCIGETIARWEVFLFLAILLQRVEFSVPLGVKVDM    421 - 490
TPIYGLTMKHACCEHFQMQLRS                                                    491 - 512
//

Text Mined References (959)

PMID Year Title
27090234 2016 Association of CYP1A1, GSTM1 and GSTT1 gene polymorphisms with risk of non-small cell lung cancer in Andhra Pradesh region of South India.
26881514 Association between CYP1A1 2454A > G polymorphism and colorectal cancer risk: A meta-analysis.
26838244 2016 Lack of Association between CYP1A1 M2 and M4 Polymorphisms and Breast Carcinoma in Jordanian Women: a Case-Control Study.
26798414 2016 Epistatic Interaction of CYP1A1 and COMT Polymorphisms in Cervical Cancer.
26782595 2016 Interaction of the CYP1A1 gene polymorphism and smoking in non-small cell lung cancer susceptibility.
26782562 2015 Correlation of CYP1A1 and GSTM1 gene polymorphisms and environmental factors to familial aggregation of esophageal cancer among the Kazakh ethnic group in Xinjiang.
26782546 2015 Analysis of CYP1A1 and COMT polymorphisms in women with cervical cancer.
26782431 2015 A case-control study of CYP2E1 (PstI) and CYP1A1 (MspI) polymorphisms in colorectal cancer.
26681006 2015 Effect of CYP1A1 and GSTM1 genetic polymorphisms on bone tumor susceptibility.
26643992 2015 CYP1A1 and CYP1A2 expression levels are differentially regulated in three-dimensional spheroids of liver cancer cells compared to two-dimensional monolayer cultures.
26598080 2015 Association of CYP1A1 A4889G and T6235C polymorphisms with the risk of sporadic breast cancer in Brazilian women.
26514676 2016 Keratinocyte Growth Factor Regulation of Aryl Hydrocarbon Receptor Activation in Colorectal Cancer Cells.
26514474 2015 Influence of the CYP1A1 T3801C Polymorphism on Tobacco and Alcohol-Associated Head and Neck Cancer Susceptibility in Northeast India.
26483235 2015 [Association between CYP1A1*2A polymorphism and susceptibility to childhood acute lymphoblastic leukemia: a Meta analysis].
26474839 2016 Impact of Alternaria toxins on CYP1A1 expression in different human tumor cells and relevance for genotoxicity.
26425562 2015 Impact of CYP1A1 Polymorphisms on Susceptibility to Chronic Obstructive Pulmonary Disease: A Meta-Analysis.
26367467 2015 Characterization of the Gly45Asp variant of human cytochrome P450 1A1 using recombinant expression.
26187180 2015 Cannabidiol induces expression of human cytochrome P450 1A1 that is possibly mediated through aryl hydrocarbon receptor signaling in HepG2 cells.
26166128 2015 Association of CYP1A1 and GSTM1 Polymorphisms With Oral Cancer Susceptibility: A Meta-Analysis.
26123186 2015 Differences in 4-hydroxyestradiol levels in leukocytes are related to CYP1A1(?)2C, CYP1B1(?)3 and COMT Val158Met allelic variants.
25934798 2015 Signal integration by the CYP1A1 promoter--a quantitative study.
25886559 2015 Association of CYP1A1 MspI polymorphism in the esophageal cancer risk: a meta-analysis in the Chinese population.
25798582 2015 Involvement of cytochrome P450 1A1 and glutathione S-transferase P1 polymorphisms and promoter hypermethylation in the progression of anti-tuberculosis drug-induced liver injury: a case-control study.
25735346 2015 Genetic susceptibility to oral cancer due to combined effects of GSTT1, GSTM1 and CYP1A1 gene variants in tobacco addicted patients of Pashtun ethnicity of Khyber Pakhtunkhwa province of Pakistan.
25730047 2015 Association between the CYP1A1 polymorphisms and hepatocellular carcinoma: a meta-analysis.
25724184 2015 Tobacco carcinogen-metabolizing genes CYP1A1, GSTM1, and GSTT1 polymorphisms and their interaction with tobacco exposure influence the risk of head and neck cancer in Northeast Indian population.
25654087 2015 The effect of CYP, GST, and SULT polymorphisms and their interaction with smoking on the risk of hepatocellular carcinoma.
25630554 2015 Association between cytochrome P450 1A1 (CYP1A1) gene polymorphisms and the risk of renal cell carcinoma: a meta-analysis.
25501250 2014 Association between CYP1A1m1 gene polymorphism and primary open-angle glaucoma.
25416956 2014 A proteome-scale map of the human interactome network.
25399436 2015 Hyperoxia-induced changes in estradiol metabolism in postnatal airway smooth muscle.
25343551 CYP1A1 Ile462Val polymorphism and the risk of non-small cell lung cancer in a Chinese population.
25306702 [DIO2, TPO, CYP1A1 AND CYP1A2 gene polymorphism in women with thyroid disease].
25304467 2015 Interaction effect of serum 25-hydroxyvitamin D levels and CYP1A1, CYP1B1 polymorphisms on blood pressure in an elderly population.
25299844 2014 Endocrine disruption in human placenta: expression of the dioxin-inducible enzyme, CYP1A1, is correlated with that of thyroid hormone-regulated genes.
25288136 2015 Genome-wide meta-analysis identifies six novel loci associated with habitual coffee consumption.
25281494 2014 Functional variants in CYP1A1 and GSTM1 are associated with clearance of cervical HPV infection.
25245543 2014 Correlation between CYP1A1 transcript, protein level, enzyme activity and DNA adduct formation in normal human mammary epithelial cell strains exposed to benzo[a]pyrene.
25189712 2014 The association between CYP1A1 genetic polymorphisms and coronary artery disease in the Uygur and Han of China.
25169514 2014 Genetic susceptibility to esophageal cancer due to CYP1A1 gene variant rs4646903 in tobacco addicted patients of Pashtun ethnicity: a case control study in Khyber Pakhtunkhwa province of Pakistan.
25150952 2014 Are CYP1A1, CYP17 and CYP1B1 mutation genes involved on girls with precocious puberty? A pilot study.
25138301 2014 Meta-analyses of the effect of CYP1A1 and CYP2D6 polymorphisms on the risk of head and neck squamous cell carcinoma.
25131582 2015 Genetic analysis of colon tumors induced by a dietary carcinogen PhIP in CYP1A humanized mice: Identification of mutation of ?-catenin/Ctnnb1 as the driver gene for the carcinogenesis.
25106409 2014 CYP1A1 polymorphism interactions with smoking status in oral cancer risk: evidence from epidemiological studies.
25068733 2014 In vitro and in vivo induction of cytochrome P450 by coplanar polychlorinated/brominated biphenyls (Co-PXBs) providing high TEQ in mother's milk in Japan.
25048966 2014 Cytochrome P450 1A1 (CYP1A1) polymorphism and susceptibility to esophageal cancer: an updated meta-analysis of 27 studies.
25040976 2014 Susceptibility of lung cancer with polymorphisms of CYP1A1, GSTM1, GSTM3, GSTT1 and GSTP1 genotypes in the population of Inner Mongolia region.
25011215 2014 The influence of soybean extract on the expression level of selected drug transporters, transcription factors and cytochrome P450 genes encoding phase I drug-metabolizing enzymes.
24969905 2014 Meta-analysis of association studies of CYP1A1 genetic polymorphisms with digestive tract cancer susceptibility in Chinese.
24957043 2014 Expression profile of CYP1A1 and CYP1B1 enzymes in endometrial tumors.
24945098 2014 Influence of CYP1A1*2C on high triglyceride levels in female Mexican indigenous Tarahumaras.
24939416 2014 CYP1A1 Ile462Val polymorphism and colorectal cancer risk in Polish patients.
24938875 2014 Combined effects of CYP1A1 MspI and GSTM1 genetic polymorphisms on risk of lung cancer: an updated meta-analysis.
24935599 2014 Lack of association between CYP1A1 polymorphisms and risk of bladder cancer: a meta-analysis.
24926919 2014 Genetic variation in the CYP1A1 gene is related to circulating PCB118 levels in a population-based sample.
24875910 2014 Association of CYP1A1, CYP1B1 and CYP17 gene polymorphisms and organochlorine pesticides with benign prostatic hyperplasia.
24851608 2014 Association study of cytochrome P450 1A1*2A polymorphism with prostate cancer risk and aggressiveness in Croatians.
24841653 2014 Association of the CYP1A1 MspI and TNF?-308 polymorphisms with chronic obstructive pulmonary disease in Inner Mongolia.
24777039 2014 A multicenter case-control study on screening of single nucleotide polymorphisms in estrogen-metabolizing enzymes and susceptibility to uterine leiomyoma in han chinese.
24671854 2014 Influence of CYP1A1, GST polymorphisms and susceptibility risk of chronic myeloid leukemia in Syrian population.
24668907 2014 Maternal smoking, xenobiotic metabolizing enzyme gene variants, and gastroschisis risk.
24657182 2014 Association of CYP1A1 gene variants rs4646903 (T>C) and rs1048943 (A>G) with cervical cancer in a North Indian population.
24647742 2015 The effect of CYP1A1 and GSTP1 isozymes on the occurrence of aortic aneurysms.
24629213 2014 Polymorphisms in phase I and phase II genes and breast cancer risk and relations to persistent organic pollutant exposure: a case-control study in Inuit women.
24626963 2014 CYP1A1 Ile462Val polymorphism as a risk factor in cervical cancer development in the Polish population.
24613751 2014 CYP1A1 gene polymorphisms and smoking status as modifier factors for lung cancer risk.
24585908 2014 Cytochrome P450-isoenzyme 1A1 in susceptibility to tobacco-related lung cancer.
24583342 2014 Palmatine activates AhR and upregulates CYP1A activity in HepG2 cells but not in human hepatocytes.
24552248 2014 Relationships between CYP1A1 genetic polymorphisms and bladder cancer risk: a meta-analysis.
24535777 2014 Association of genetic variants of xenobiotic and estrogen metabolism pathway (CYP1A1 and CYP1B1) with gallbladder cancer susceptibility.
24527758 2014 Genetic variations in the xenobiotic-metabolizing enzymes CYP1A1, CYP1A2, CYP2C9, CYP2C19 and susceptibility to colorectal cancer among Turkish people.
24508281 2014 Impact of CYP1A1, GSTM1, and GSTT1 polymorphisms in overall and specific prostate cancer survival.
24504680 2014 CYP1A1 and CYP2E1 genotypes and risk of esophageal squamous cell carcinoma in a high-incidence region, Kashmir.
24498651 2014 Association between the CYP1A1 T3801C polymorphism and risk of cancer: evidence from 268 case-control studies.
24488272 2014 Combined effects of urinary phytoestrogens metabolites and polymorphisms in metabolic enzyme gene on idiopathic male infertility.
24466186 2014 Association between 3801T>C polymorphism of CYP1A1 and idiopathic male infertility risk: a systematic review and meta-analysis.
24460333 2013 Clinical, cytogenetic and CYP1A1 exon-1 gene mutation analysis of Beedi workers in Vellore region, Tamil Nadu.
24460273 2013 Expression of CYP1A1 and GSTP1 in human brain tumor tissues in Pakistan.
24449363 2014 Association of CYP1A1 and CYP2D6 gene polymorphisms with head and neck cancer in Tunisian patients.
24443269 2014 The effect of CYP1A1 and CYP1A2 polymorphisms on gastric cancer risk among different ethnicities: a systematic review and meta-analysis.
24391993 2013 MspI and Ile462Val polymorphisms in CYP1A1 and overall cancer risk: a meta-analysis.
24382322 2014 Dephosphorylation of Sp1 at Ser-59 by protein phosphatase 2A (PP2A) is required for induction of CYP1A1 transcription after treatment with 2,3,7,8-tetrachlorodibenzo-p-dioxin or omeprazole.
24377558 2014 CYP1A1 genetic polymorphisms and risk for esophageal cancer: a case-control study in central China.
24358191 2013 Expression profile of CYP1A1 and CYP1B1 enzymes in colon and bladder tumors.
24355420 2014 Hypoxia perturbs aryl hydrocarbon receptor signaling and CYP1A1 expression induced by PCB 126 in human skin and liver-derived cell lines.
24320736 2014 Role of single nucleotide polymorphisms in estrogen-metabolizing enzymes and susceptibility to uterine leiomyoma in Han Chinese: a case-control study.
24316127 2014 The Cytochrome P4501A1 gene polymorphisms and idiopathic male infertility risk: a meta-analysis.
24307623 2014 Association between the CYP1A1 A2455G polymorphism and risk of cancer: evidence from 272 case-control studies.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24168324 2014 Cytochrome P450 isoforms are differently up-regulated in aflatoxin B?-exposed human lymphocytes and monocytes.
24096584 2014 Mutation and protein expression analysis of CYP1A1 gene-a study on female breast cancer cases from India.
24091107 2013 Dexamethasone accelerates degradation of aryl hydrocarbon receptor (AHR) and suppresses CYP1A1 induction in placental JEG-3 cell line.
24084344 2013 Cytogenetic damage in Turkish coke oven workers exposed to polycyclic aromatic hydrocarbons: Association with CYP1A1, CYP1B1, EPHX1, GSTM1, GSTT1, and GSTP1 gene polymorphisms.
24068433 2013 CYP1A1, GCLC, AGT, AGTR1 gene-gene interactions in community-acquired pneumonia pulmonary complications.
24065535 2013 Association between CYP1A1 polymorphisms and esophageal cancer: a meta-analysis.
23918309 2013 Association between cytochrome P450 1A1 MspI polymorphism and endometrial cancer risk: a meta-analysis.
23886179 2013 Cytochrome P450 1A1, 2E1 and GSTM1 gene polymorphisms and susceptibility to colorectal cancer in the Saudi population.
23873331 2013 Expression of CYP1A1, CYP1B1 and MnSOD in a panel of human cancer cell lines.
23870476 2013 Relationship between CYP1A1 polymorphisms and invasion and metastasis of breast cancer.
23860774 2013 Quantitative assessment of the association between CYP1A1 A4889G polymorphism and endometrial cancer risk.
23852617 2014 Common polymorphisms in the CYP1A1 and CYP11A1 genes and polycystic ovary syndrome risk: a meta-analysis and meta-regression.
23848208 2013 CYP1A1 gene polymorphisms and polycystic ovary syndrome risk: a meta-analysis and meta-regression.
23842721 2013 Clinical effects of A4889G and T6235C polymorphisms in cytochrome P-450 CYP1A1 for breast cancer patients treated with tamoxifen: implications for tumor aggressiveness and patient survival.
23840148 2013 CYP1A1, GSTM1, GSTT1 and NQO1 polymorphisms and colorectal adenomas in Japanese men.
23832578 2013 CYP1A1 exon7 polymorphism is associated with lung cancer risk among the female population and among smokers: a meta-analysis.
23816456 2013 CYP1A1 genetic polymorphism and polycyclic aromatic hydrocarbons on pulmonary function in the elderly: haplotype-based approach for gene-environment interaction.
23785672 2013 Genetic polymorphisms in CYP1A1, CYP1B1 and COMT genes in Greenlandic Inuit and Europeans.
23733671 2013 Profiling deleterious non-synonymous SNPs of smoker's gene CYP1A1.
23725389 2014 Polymorphism of CYP1A1 gene and susceptibility to childhood acute lymphoblastic leukemia in Egypt.
23707957 2013 Novel insights into etiologies of leukemia: a HuGE review and meta-analysis of CYP1A1 polymorphisms and leukemia risk.
23661361 2013 The potential effect of gender in CYP1A1 and GSTM1 genotype-specific associations with pediatric brain tumor.
23619522 2013 Association of CYP1A1 gene polymorphism with chronic kidney disease: a case control study.
23576571 2013 CYP1A1 regulates breast cancer proliferation and survival.
23548414 2013 Smoking status modifies the relation between CYP1A1*2C gene polymorphism and idiopathic male infertility: the importance of gene-environment interaction analysis for genetic studies of the disease.
23528250 2013 Genetic association of aromatic hydrocarbon receptor (AHR) and cytochrome P450, family 1, subfamily A, polypeptide 1 (CYP1A1) polymorphisms with dioxin blood concentrations among pregnant Japanese women.
23508959 2013 Human cytochrome P450 1A1 structure and utility in understanding drug and xenobiotic metabolism.
23492908 2013 Influence of CYP1A1/CYP1A2 and AHR polymorphisms on systemic olanzapine exposure.
23475304 2013 CYP1A1 MspI polymorphism is associated with prostate cancer susceptibility: evidence from a meta-analysis.
23471717 2013 CYP2A6, CYP1A1, and CYP2D6 polymorphisms in lung cancer patients from central south China.
23462525 2013 Functional CYP1A1 genetic variants, alone and in combination with smoking, contribute to development of head and neck cancers.
23444898 2014 Gene polymorphisms, tobacco exposure and oral cancer susceptibility: a study from Gujarat, West India.
23424205 2013 Effects of ?-glucan extracted from Agaricus blazei on the expression of ERCC5, CASP9, and CYP1A1 genes and metabolic profile in HepG2 cells.
23419638 2013 Pelargonidin activates the AhR and induces CYP1A1 in primary human hepatocytes and human cancer cell lines HepG2 and LS174T.
23411129 2013 Functional polymorphisms in the CYP1A1, ACE, and IL-6 genes contribute to susceptibility to community-acquired and nosocomial pneumonia.
23381648 2013 Quantitative synthesis of the association between the cytochrome P450 1A1 Ile462Val polymorphism and prostate cancer risk.
23369756 2013 Differential modulation of cytochrome P450 1a1 by arsenite in vivo and in vitro in C57BL/6 mice.
23353840 2012 Theoretical investigation of differences in nitroreduction of aristolochic acid I by cytochromes P450 1A1, 1A2 and 1B1.
23350368 2012 [LOH and genetic polymorphysms of breast cancer].
23293967 2013 Association of gene polymorphism in detoxification enzymes and urinary 8-OHdG levels in traffic policemen exposed to vehicular exhaust.
23288144 2013 Sunitinib, a tyrosine kinase inhibitor, induces cytochrome P450 1A1 gene in human breast cancer MCF7 cells through ligand-independent aryl hydrocarbon receptor activation.
23275542 2013 2,3,7,8-Tetrachlorodibenzo-p-dioxin poly(ADP-ribose) polymerase (TiPARP, ARTD14) is a mono-ADP-ribosyltransferase and repressor of aryl hydrocarbon receptor transactivation.
23259321 2012 Role of CYP1A1 haplotypes in modulating susceptibility to coronary artery disease.
23229202 2013 Lack of association between CYP1A1 T6235C polymorphism and coronary artery disease: evidence from a meta-analysis.
23178447 2013 Lung cancer risk in relation to nicotinic acetylcholine receptor, CYP2A6 and CYP1A1 genotypes in the Bangladeshi population.
23174221 2013 Beta-catenin signaling induces CYP1A1 expression by disrupting adherens junctions in Caco-2 human colon carcinoma cells.
23152866 2012 Interaction between maternal passive smoking during pregnancy and CYP1A1 and GSTs polymorphisms on spontaneous preterm delivery.
23124075 2013 CYP1AI and CYP2E1 gene polymorphisms may increase susceptibility to oral submucous fibrosis among betel quid chewers of eastern India.
23111888 2013 Cytochrome P4501A1 genotypes and smoking- and hypertension-related ischemic stroke risk.
23098461 2012 Lack of association between the CYP1A1 Ile462Val polymorphism and endometrial cancer risk: a meta-analysis.
23065291 2013 Genetic polymorphisms of NQO1, CYP1A1 and TPMT and susceptibility to acute lymphoblastic leukemia in a Tunisian population.
23065259 2012 Association of CYP1A1 polymorphisms with prostate cancer risk: an updated meta-analysis.
23056546 2012 Association between CYP1A1 Ile462Val variation and acute leukemia risk: meta-analyses including 2164 cases and 4160 controls.
23055196 2013 Significant association between CYP1A1 T3801C polymorphism and cervical neoplasia risk: a systematic review and meta-analysis.
23046808 2012 Maternal obesity alters feto-placental cytochrome P4501A1 activity.
23033491 2013 Antitumor activity of a duocarmycin analogue rationalized to be metabolically activated by cytochrome P450 1A1 in human transitional cell carcinoma of the bladder.
23013535 2012 Genetic polymorphisms in CYP1A1, GSTM1, GSTP1 and GSTT1 metabolic genes and risk of lung cancer in Asturias.
23000097 2013 Polymorphisms of catechol estrogens metabolism pathway genes and breast cancer risk in Mexican women.
22997752 2012 [Chronic inflammatory and dystrophic diseases of the eye anterior segment and their association with genetic polymorphisms in workers of metallurgic industry].
22994769 2012 CYP1A1 gene polymorphisms: modulator of genetic damage in coal-tar workers.
22964275 2012 Does cytochrome P450 1A1 MspI polymorphism increase acute lymphoblastic leukemia risk? Evidence from 2013 cases and 2903 controls.
22952673 2012 CYP1A1 Ile462Val polymorphism contributes to lung cancer susceptibility among lung squamous carcinoma and smokers: a meta-analysis.
22951721 2013 Aryl hydrocarbon receptor repressor (AhRR) function revisited: repression of CYP1 activity in human skin fibroblasts is not related to AhRR expression.
22949628 2012 Preferred binding orientations of phenacetin in CYP1A1 and CYP1A2 are associated with isoform-selective metabolism.
22948778 2012 CYP1A1 Ile462Val polymorphism and cervical cancer: evidence from a meta-analysis.
22918668 2013 Expression patterns of carcinogen detoxifying genes (CYP1A1, GSTP1 & GSTT1) in HNC patients.
22909097 2012 Quantitative assessment of CYP1A1*2A variations with oral carcinoma susceptibility: evidence from 1,438 cases and 2,086 controls.
22901117 2012 Down-regulation of CYP1A1 expression in breast cancer.
22893352 2012 The effect of CYP1A1, GSTT1 and GSTM1 polymorphisms on the risk of lung cancer: a case-control study.
22876118 2012 CYP1A1 protein activity is associated with allelic variation in pterygium tissues and cells.
22855999 2012 [Association of polymorph variants of CYP1A2 and CYP1A1 genes with reproductive and thyroid diseases in female workers of petrochemical industry].
22854411 2012 Associations between polymorphisms in the AHR and CYP1A1-CYP1A2 gene regions and habitual caffeine consumption.
22847262 2012 Cytochrome P450 1A1 Ile462Val polymorphism and oral carcinoma risk: an updated meta-analysis including 1,515 cases and 2,233 controls.
22846179 2012 CYP1A1 MspI polymorphism and acute myeloid leukemia risk: meta-analyses based on 5018 subjects.
22837390 2012 Vitamin D receptor activation enhances benzo[a]pyrene metabolism via CYP1A1 expression in macrophages.
22782580 2012 Lack of association of CYP1A1-MspI SNP and GSTM1 null genotypes with cancer in a Brazilian family with unusually high cancer incidence.
22754477 2012 Breast cancer risk, fungicide exposure and CYP1A1*2A gene-environment interactions in a province-wide case control study in Prince Edward Island, Canada.
22752755 2012 Association of CYP1A1, GSTM1, and GSTT1 gene polymorphism with risk of oral submucous fibrosis in a section of North Indian population.
22733497 2012 Cytochrome P450 1A1 (CYP1A1) gene polymorphisms and ovarian cancer risk: a meta-analysis.
22707145 2012 Meta-analysis of the association of CYP1A1 polymorphisms with gastric cancer susceptibility and interaction with tobacco smoking.
22664944 2013 Association of the CYP1A1*2A, GSTT1 null, GSTM1 null, mEPHX*3, and XRCC1-399 genetic polymorphisms with ulcerative colitis.
22660220 2012 Genetic polymorphism of drug metabolizing enzymes (GSTM1 and CYP1A1) as risk factors for oral premalignant lesions and oral cancer.
22611936 2012 [Association between genetic polymorphism of metabolizing enzymes and DNA repairing enzymes and the susceptibility of lung cancer in Henan population].
22594779 2012 Cytochrome 1A1 and 1B1 gene diversity in the Zanzibar islands.
22579698 2012 CYP1A1 MspI polymorphisms and lung cancer risk: an updated meta-analysis involving 20,209 subjects.
22470100 2012 CYP1A1 is a target of miR-892a-mediated post-transcriptional repression.
22448487 [The role of mutation of gene cyp1A1 and benzapilene in cytogenetic changes of urinary tract epitheliocytes in oil industry workers employed in the oil fields of the North of West Siberia].
22442665 2012 TLR2 controls intestinal carcinogen detoxication by CYP1A1.
22422552 2012 Quercetin, quercetin glycosides and taxifolin differ in their ability to induce AhR activation and CYP1A1 expression in HepG2 cells.
22395499 2012 Validation of PCR-RFLP techniques for the evaluation of codon 72 of p53 and CYP1A1 gene's polymorphisms in relation with ovarian cancer in a Romanian population.
22392998 2012 Inhibition of cytochrome P4501-dependent clearance of the endogenous agonist FICZ as a mechanism for activation of the aryl hydrocarbon receptor.
22384629 2011 Importance of CYP1A1 polymorphism and its transcriptional regulation in ovarian and endometrial cancer.
22374940 2012 Carnosol, a constituent of Zyflamend, inhibits aryl hydrocarbon receptor-mediated activation of CYP1A1 and CYP1B1 transcription and mutagenesis.
22365406 2011 Meta-analysis of cytochrome P4501A1 MspI gene polymorphism and childhood acute leukemia.
22359202 2012 Quantitative assessment of the associations between CYP1A1 polymorphisms and gastric cancer risk.
22312901 2011 [Genetic study of predisposition to community-acquired pneumonia].
22311486 2012 [Effects of CYP1A1 and GSTM1 gene polymorphisms and BPDE-DNA adducts on lung cancer].
22304463 2012 Lack of association of CYP1A1 polymorphism with prostate cancer susceptibility of Tunisian men.
22297691 2012 Interactions between CYP1A1 polymorphisms and cigarette smoking are associated with the risk of hepatocellular carcinoma: evidence from epidemiological studies.
22296350 2011 Relationship between CYP1A1 genetic polymorphisms and renal cancer in China.
22294106 2012 Cytochrome P450 1A1 (CYP1A1) gene polymorphisms and cervical cancer risk: a meta-analysis.
22292665 2011 CYP1A1 gene polymorphisms: lack of association with breast cancer susceptibility in the southern region (Madurai) of India.
22281432 2013 Risk of renal cell carcinoma and polymorphism in phase I xenobiotic metabolizing CYP1A1 and CYP2D6 enzymes.
22277800 2012 CYP1A1 Ile462Val is a risk factor for ovarian cancer development.
22273851 2012 Effects of cytochrome P450 1A1 and uridine-diphosphate-glucuronosyltransferase 1A1 allelic polymorphisms on the risk of development and the prognosis of head and neck cancers.
22236719 2012 The relationship among IL-13, GSTP1, and CYP1A1 polymorphisms and environmental tobacco smoke in a population of children with asthma in Northern Mexico.
22217397 2012 Risk modification by CYP1A1 and GSTM1 polymorphisms in the association of cigarette smoking and systemic lupus erythematosus in a Japanese population.
22213191 2012 DNA methylation of the CYP1A1 enhancer is associated with smoking-induced genetic alterations in human lung.
22183307 2012 Common polymorphisms in CYP1A1, GSTM1, GSTT1, GSTP1 and XPD genes and endogenous DNA damage.
22154617 2011 Effect of CYP1A1 MSPI polymorphism on the relationship between TP53 mutation and CDKN2A hypermethylation in non-small cell lung cancer.
22109568 2012 Polymorphisms in GSTM1, CYP1A1, CYP2E1, and CYP2D6 are associated with susceptibility and chemotherapy response in non-small-cell lung cancer patients.
22088806 2012 Associations between CYP1A1 and CYP2E1 polymorphisms and susceptibility to esophageal cancer in Chaoshan and Taihang areas of China.
22086975 2012 Bioactivation versus detoxication of the urothelial carcinogen aristolochic acid I by human cytochrome P450 1A1 and 1A2.
22025136 2011 CYP1A1 Ile462Val polymorphism and susceptibility to lung cancer: a meta-analysis based on 32 studies.
22018952 2012 CYP1AI, glutathione S-transferase gene polymorphisms and risk of Polycythemia vera.
22000673 2012 Risk factor for clear cell renal cell carcinoma in Chinese population: a case-control study.
21977969 2012 Genetic polymorphism of estrogen metabolizing enzymes in Siberian women with breast cancer.
21909115 2011 Genetic variants in novel pathways influence blood pressure and cardiovascular disease risk.
21876539 2012 Genome-wide association analysis of coffee drinking suggests association with CYP1A1/CYP1A2 and NRCAM.
21870186 2011 CYP1A1, GSTM1 and GSTT1 polymorphisms, tobacco and alcohol status and risk of head and neck squamous cell carcinoma.
21869479 2011 Role of CYP1A1 (T6235C) polymorphism and cigarette smoking in the development of coronary heart disease in Tunisian population.
21859547 2011 [CYP1A1 gene and GSTM1 gene polymorphism and the combined effects and risk of lung cancer: a meta-analysis].
21848428 2012 Impact of genetic variations of the CYP1A1, GSTT1, and GSTM1 genes on the risk of coronary artery disease.
21775774 2012 Analysis of GSTM1, GSTT1, and CYP1A1 in idiopathic male infertility.
21718208 2011 Associations of xenobiotic-metabolizing enzyme genotypes PON1Q192R, PON1L55M and CYP1A1*2A MspI with pathological symptoms of a rural population in south Greece.
21710246 2012 Association between CYP1A1 polymorphism and colorectal cancer risk: a meta-analysis.
21709011 The effect of CYP1A1 and GSTM1 gene polymorphisms in bladder cancer development in a Turkish population.
21590276 2012 Polymorphisms of the CYP1A1 and CYP2E1 genes in head and neck squamous cell carcinoma risk.
21586621 2011 Polymorphisms in CYP1A1 and ethnic-specific susceptibility to acute lymphoblastic leukemia in children.
21545219 2011 Genetic variation in carcinogen metabolizing genes associated with oral cancer in pakistani population.
21545198 2011 Expression of xenobiotic metabolizing genes in head and neck cancer tissues.
21508386 2011 Polymorphisms of the CYP1A1, CYP2E1 and XRCC1 genes and cancer risk in a Southern Italian population: a case-control study.
21490707 2011 Genome-wide meta-analysis identifies regions on 7p21 (AHR) and 15q24 (CYP1A2) as determinants of habitual caffeine consumption.
21438753 2011 Soy isoflavones, CYP1A1, CYP1B1, and COMT polymorphisms, and breast cancer: a case-control study in southwestern China.
21418988 2011 [Study of cytochrome P450 1A1 gene 3'-UTR 6235T-C polymorphism and susceptibility to breast cancer with Uighur medicine].
21402622 2011 The effect of CYP1A1 polymorphisms on the risk of lung cancer: a global meta-analysis based on 71 case-control studies.
21385088 2011 CYP1A1, CYP2E1, and GSTM1 gene polymorphisms and susceptibility to colorectal and gastric cancer among Lebanese.
21357676 2011 Sequence variants at CYP1A1-CYP1A2 and AHR associate with coffee consumption.
21329749 2011 Modulation of CYP1A1 activity by a Ginkgo biloba extract in the human intestinal Caco-2 cells.
21304969 2011 CYP1A1 induction in the colon by serum: involvement of the PPAR? pathway and evidence for a new specific human PPRE? site.
21270613 2011 Cytochrome P450 1A1 gene polymorphisms and endometrial cancer risk: a meta-analysis.
21262253 2011 Induction of cytochromes P450 1A1 and 1A2 by tanshinones in human HepG2 hepatoma cell line.
21254556 2010 [Cytochrome P4501A1, glutathione S-transferase M1 and T1 gene polymorphisms in chronic myeloid leukemia].
21254355 2011 Smoking, the xenobiotic pathway, and clubfoot.
21246002 2011 CYP1A1 Ile462Val polymorphism contributes to colorectal cancer risk: a meta-analysis.
21211368 2010 [CYP1A1 polymorphisms, lack of glutathione S-transferase M1 (GSTM1), cooking oil fumes and lung cancer risk in non-smoking women].
21130723 2011 A remark about CYP1A1 Thr461Asn genotype frequencies in a recent endometrial cancer case-control study.
21086258 2010 Involvement of CYP1A1, GST, 72TP53 polymorphisms in the pathogenesis of thyroid nodules.
21081473 2011 Genetic variation in the bioactivation pathway for polycyclic hydrocarbons and heterocyclic amines in relation to risk of colorectal neoplasia.
20970553 2010 Toward personalized medicine in renal transplantation.
20965504 2011 CYP1A1 polymorphism in adolescents with polycystic ovary syndrome.
20962519 2010 Increased risk for acute lymphoblastic leukemia in children with cytochrome P450A1 (CYP1A1)- and NAD(P)H:quinone oxidoreductase 1 (NQO1)-inherited gene variants.
20957336 CYP1A2*1F and GSTM1 alleles are associated with susceptibility to porphyria cutanea tarda.
20937634 2010 Cigarette smoking, genetic variants in carcinogen-metabolizing enzymes, and colorectal cancer risk.
20887941 2010 Smoking related risk involved in individuals carrying genetic variants of CYP1A1 gene in head and neck cancer.
20886582 2010 Interactions between cigarette smoking and selected polymorphisms in xenobiotic metabolizing enzymes in risk for colorectal cancer: A case-only analysis.
20884258 Evaluation of the influence of polymorphic variants CYP1A1 2B, CYP1B1 2, CYP3A4 1B, GSTM1 0, and GSTT1 0 in prostate cancer.
20883830 2011 Inhibition of 17?-estradiol activation by CYP1A1: genotype- and regioselective inhibition by St. John's Wort and several natural polyphenols.
20878621 Impact of CYP1A1 and COMT genotypes on breast cancer risk in Mexican women: a pilot study.
20878561 2011 Genetic polymorphisms of metabolic enzymes-CYP1A1, CYP2D6, GSTM1, and GSTT1, and gastric carcinoma susceptibility.
20855412 2010 CYP1A1 modifies the effect of maternal exposure to environmental tobacco smoke on child behavior.
20850372 2010 Influence of genetic polymorphisms on frequency of micronucleated buccal epithelial cells in leukoplakia patients.
20846153 2010 Hypermethylation of carcinogen metabolism genes, CYP1A1, CYP2A13 and GSTM1 genes in head and neck cancer.
20845989 2010 CYP and GST polymorphisms and survival in advanced non-small cell lung cancer patients.
20817259 2010 CYP 1A1 polymorphism and organochlorine pesticides levels in the etiology of prostate cancer.
20804547 2010 CYP1A1 gene polymorphisms increase lung cancer risk in a high-incidence region of Spain: a case control study.
20734807 [The relationship between genotypes and frequencies of chromosome aberrations in human lymphocytes under irradiation in vivo and in vitro].
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20723587 2010 Oxidative damage to biological macromolecules in Prague bus drivers and garagemen: impact of air pollution and genetic polymorphisms.
20704749 2010 Combined effects of cigarette smoking, gene polymorphisms and methylations of tumor suppressor genes on non small cell lung cancer: a hospital-based case-control study in China.
20701904 2010 Early life environment, neurodevelopment and the interrelation with atopy.
20700368 2010 An association between BPDE-like DNA adduct levels and CYP1A1 and GSTM1 polymorphisma in pterygium.
20664892 2010 CYP1A1, smoking and venous thromboembolism.
20661821 2010 Association of xenobiotic metabolizing enzymes genetic polymorphisms with esophageal cancer in Kashmir Valley and influence of environmental factors.
20644561 2011 A large-scale candidate gene approach identifies SNPs in SOD2 and IL13 as predictive markers of response to preoperative chemoradiation in rectal cancer.
20638923 2011 Combined effects of serum trace metals and polymorphisms of CYP1A1 or GSTM1 on non-small cell lung cancer: a hospital based case-control study in China.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20628863 2010 Methylation patterns of genes coding for drug-metabolizing enzymes in tamoxifen-resistant breast cancer tissues.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20596254 2010 CYP1A1 gene polymorphisms as a risk factor for pterygium.
20584197 2010 Prevalence of the MspI and Ile462Val SNPs of cytochrome P-450 1A1 in hidradenitis suppurativa.
20579990 2010 The role of MSP I CYP1A1 gene polymorphism in the development of uterine fibroids.
20559649 2011 Is genetic polymorphism of ER-?, CYP1A1, and CYP1B1 a risk factor for uterine leiomyoma?
20554493 2010 Gene-gene interactions of drug metabolizing enzymes and transporter protein in the risk of upper aerodigestive tract cancers among Indians.
20544687 Evidence that genetic variants of metabolic detoxication and cell cycle control are not related to gallbladder cancer risk in Chilean women.
20534171 2010 Cigarette smoking, genetic polymorphisms and colorectal cancer risk: the Fukuoka Colorectal Cancer Study.
20529763 2010 Evaluation of candidate genes for cholinesterase activity in farmworkers exposed to organophosphorus pesticides: association of single nucleotide polymorphisms in BCHE.
20511665 2010 Candidate gene association studies and risk of childhood acute lymphoblastic leukemia: a systematic review and meta-analysis.
20491576 2010 Combined effect of smoking and polymorphisms in tobacco carcinogen-metabolizing enzymes CYP1A1 and GSTM1 on the head and neck cancer risk in North Indians.
20462615 2010 In utero tobacco exposure epigenetically modifies placental CYP1A1 expression.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20437850 Alcohol, tobacco and genetic susceptibility in relation to cancers of the upper aerodigestive tract in northern Italy.
20428802 2010 Additional candidates to conventional genes susceptible for lung cancer and changing trend in Japan.
20381444 2010 Polymorphisms in genes of the steroid hormone biosynthesis and metabolism pathways and endometrial cancer risk.
20377136 2010 The CYP1A1 Ile462Val polymorphism and platinum resistance of epithelial ovarian neoplasms.
20375710 2010 Polymorphisms in xenobiotic metabolizing enzymes and diet influence colorectal adenoma risk.
20373852 2010 Microarray-based detection of CYP1A1, CYP2C9, CYP2C19, CYP2D6, GSTT1, GSTM1, MTHFR, MTRR, NQO1, NAT2, HLA-DQA1, and AB0 allele frequencies in native Russians.
20345875 2011 CYP1A1, CYP3A5 and CYP3A7 polymorphisms and testicular cancer susceptibility.
20297661 2010 [Analysis of genetic predisposition to pulmonary tuberculosis in native Russians].
20226777 2010 Association of GSTT1, GSTM1 and CYP1A1 polymorphisms with susceptibility to systemic lupus erythematosus in the Chinese population.
20214802 2010 Genetic variation in the estrogen metabolic pathway and mammographic density as an intermediate phenotype of breast cancer.
20193595 2009 [Study on the association of cytochrome P450 polymorphisms and the risk of esophageal cancer: a meta-analysis].
20177288 2010 Pharmacogenomics of maternal tobacco use: metabolic gene polymorphisms and risk of adverse pregnancy outcomes.
20136364 2010 Errors and reproducibility of DNA array-based detection of allelic variants in ADME genes: PHARMAchip.
20131310 2010 Genetic polymorphisms in cytochrome P450s, GSTs, NATs, alcohol consumption and risk of non-Hodgkin lymphoma.
20095411 2009 [Role of xenobiotic biotransformation enzymes in respiratory diseases caused by dust].
20094781 2010 The association between a functional CYP1A1 polymorphism and colorectal neoplasia risk in post menopausal women.
20088394 2009 Studies on CYP1A1, CYP1B1 and CYP3A4 gene polymorphisms in breast cancer patients.
20088379 [Association of xenobiotic-metabolizing gene polymorphisms with childhood atopic diseases in Russian patients from the Republic of Bashkortostan].
20080081 2010 CYP1A1, CYP1A2 and CYBA gene polymorphisms associated with oxidative stress in COPD.
20054510 CYP1A1 m1 and m2 polymorphisms: genetic susceptibility to lung cancer.
20052535 2010 Lack of significant association between CYP1A1 T3801C polymorphism and breast cancer risk: a meta-analysis involving 25,087 subjects.
20047124 2009 Association between dietary heterocyclic amine levels, genetic polymorphisms of NAT2, CYP1A1, and CYP1A2 and risk of stomach cancer: a hospital-based case-control study in Japan.
20035380 2010 Four polymorphisms in cytochrome P450 1A1 (CYP1A1) gene and breast cancer risk: a meta-analysis.
20032816 2010 The GSTP1 Ile105 Val polymorphism modifies the metabolism of toluene di-isocyanate.
20029944 2010 Genetic polymorphisms in the metabolic pathway and non-Hodgkin lymphoma survival.
20027111 2010 Review of studies on metabolic genes and cancer in populations of African descent.
20012094 2010 Gene-environment interactions associated with CYP1A1 MspI and GST polymorphisms and the risk of upper aerodigestive tract cancers in an Indian population.
20009880 2009 CYP1A1 and CYP2D6 gene polymorphisms in Israeli Jewish women with cervical cancer.
19995559 2010 Correlation of xenobiotic-metabolizing enzymes, oxidative stress and NFkappaB signaling with histological grade and menopausal status in patients with adenocarcinoma of the breast.
19963139 2010 Genetic polymorphisms in cytochrome P450 genes are associated with an increased risk of squamous cell carcinoma of the larynx and hypopharynx in a Chinese population.
19963114 2009 Effect of combined genetic polymorphisms on lung cancer risk in northern Thai women.
19954069 2009 [Association of nasopharyngeal carcinoma risk with cytochrome P450 CYP1A1 gene polymorphisms].
19954068 2009 [A case-control study of environmental and genetic factors and prostate cancer in Guangdong].
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19947517 [The effect of polymorphism of genes of xenobiotics detoxication on the frequencies of spontaneous and induced chromosome aberrations in human lymphocytes].
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19903800 2010 Herpesvirus type 7 infection may play an important role in individuals with a genetic profile of susceptibility to Graves' disease.
19899130 2009 Polymorphisms of drug-metabolizing genes and risk of non-Hodgkin lymphoma.
19892789 2010 Genetic association of phase I and phase II detoxification genes with recurrent miscarriages among North Indian women.
19863350 2010 Possible risk modification by polymorphisms of estrogen metabolizing genes in familial breast cancer susceptibility in an Indian population.
19860743 2010 Effect of gene-environment Interactions on mental development in African American, Dominican, and Caucasian mothers and newborns.
19827888 CYP1A1 polymorphisms and risk of lung cancer in the ethnic Kashmiri population.
19826048 2009 Candidate gene association study of esophageal squamous cell carcinoma in a high-risk region in Iran.
19822571 2009 Genetic variations in xenobiotic metabolic pathway genes, personal hair dye use, and risk of non-Hodgkin lymphoma.
19799358 [The association of TCR-mutant cells with DNA polymorphism in women residing in radiation polluted regions of the Russian Federation].
19797843 2009 [Adverse birth outcomes of maternal smoking during pregnancy and genetic polymorphisms: exploiting gene-environment interaction].
19789301 2009 UVR exposure sensitizes keratinocytes to DNA adduct formation.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19786002 2009 Association of CYP1A1*2A polymorphism with male infertility in Indian population.
19776291 2010 Association of testicular germ cell tumor with polymorphisms in estrogen receptor and steroid metabolism genes.
19751749 2009 Risk of malignant pleural mesothelioma and polymorphisms in genes involved in the genome stability and xenobiotics metabolism.
19750329 2009 Polymorphism of the CYP1A1*2A gene and susceptibility to lung cancer in a Brazilian population.
19718946 2009 Prevalence of CYP1A1 and GST polymorphisms in the population of northeastern India and susceptibility of oral cancer.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19682433 2010 Constitutive androstane receptor transcriptionally activates human CYP1A1 and CYP1A2 genes through a common regulatory element in the 5'-flanking region.
19679043 2009 African American-preponderant single nucleotide polymorphisms (SNPs) and risk of breast cancer.
19666078 2009 CYP1-mediated antiproliferative activity of dietary flavonoids in MDA-MB-468 breast cancer cells.
19650794 2010 CYP1A1 MSPI (T6235C) gene polymorphism is associated with mortality in acute coronary syndrome patients.
19643819 2009 Interaction between cytochrome P450 1A2 genetic polymorphism and cigarette smoking on the risk of hepatocellular carcinoma in a Japanese population.
19639480 2009 Polymorphism in cytochrome P4501A1 is significantly associated with head and neck cancer risk.
19632247 2009 Evidence for increased cytochrome P450 1A1 expression in blood lymphocytes of lung cancer patients.
19630952 2009 Sex steroid metabolism polymorphisms and mammographic density in pre- and early perimenopausal women.
19627379 2010 Effect modification of endocrine disruptors and testicular germ cell tumour risk by hormone-metabolizing genes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19608585 2010 Genetic association study of CYP1A1 polymorphisms identifies risk haplotypes in nonsmall cell lung cancer.
19598235 2009 Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome.
19582785 2010 Methods for detecting interactions between genetic polymorphisms and prenatal environment exposure with a mother-child design.
19576320 2009 Relation of genetic polymorphisms in the cytochrome P450 gene with clopidogrel resistance after drug-eluting stent implantation in Koreans.
19575027 2009 Genetic variation of genes for xenobiotic-metabolizing enzymes and risk of bronchial asthma: the importance of gene-gene and gene-environment interactions for disease susceptibility.
19574343 2009 Quantitative trait loci predicting circulating sex steroid hormones in men from the NCI-Breast and Prostate Cancer Cohort Consortium (BPC3).
19563927 2009 Polymorphisms of cytochrome P450 1A1, cigarette smoking and risk of coronary artery disease.
19561157 2009 Combination of TNF-RII, CYP1A1 and GSTM1 polymorphisms and the risk of Japanese SLE: findings from the KYSS study.
19538838 2009 [Relationship between CYP1A1 gene polymorphisms and urinary 1-hydroxypyrene levels in coke oven workers].
19537956 2009 CYP1A1 genotype modifies the impact of smoking on effectiveness of HAART among women.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19526463 Investigations of the posttranslational mechanism of arsenite-mediated downregulation of human cytochrome P4501A1 levels: the role of heme oxygenase-1.
19521675 2009 Role of xenobiotic-metabolizing enzyme gene polymorphisms and interactions with environmental factors in susceptibility to gastric cancer in Kashmir Valley.
19507064 2009 Lack of an association between CYP1A1 gene Ile462Val polymorphism and polycystic ovary syndrome in Chinese.
19507017 2009 Genetic polymorphisms of cytochrome p450 and matrix metalloproteinase in chronic obstructive pulmonary disease.
19505920 2009 Single and multigenic analysis of the association between variants in 12 steroid hormone metabolism genes and risk of prostate cancer.
19479063 2009 Phase I metabolic genes and risk of lung cancer: multiple polymorphisms and mRNA expression.
19472123 2009 CYP1A1 polymorphisms and risk of prostate cancer: a meta-analysis.
19469619 GSTM1, GSTT1 and CYP1A1 polymorphisms and risk of oral cancer: a case-control study in Jakarta, Indonesia.
19456854 2009 High risk of 'de novo' acute myeloid leukaemia in individuals with cytochrome P450 A1 (CYP1A1) and NAD(P)H:quinone oxidoreductase 1 (NQO1) gene defects.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19452301 2009 Association between dietary heterocyclic amine levels, genetic polymorphisms of NAT2, CYP1A1, and CYP1A2 and risk of colorectal cancer: a hospital-based case-control study in Japan.
19443378 2009 Genetic polymorphisms in CYP1A1, CYP1B1, COMT, GSTP1 and NAT2 genes and association with bladder cancer risk in a French cohort.
19430483 2009 Genome-wide association study identifies eight loci associated with blood pressure.
19427967 2009 Association studies of CYP1A1 and GSTM1 polymorphisms with esophageal cancer risk: evidence-based meta-analyses.
19424794 2010 Genetic polymorphisms in phase I and phase II enzymes and breast cancer risk associated with menopausal hormone therapy in postmenopausal women.
19424633 2009 Anticancer effects of the flavonoid diosmetin on cell cycle progression and proliferation of MDA-MB 468 breast cancer cells due to CYP1 activation.
19415745 2009 Genetic polymorphisms of estrogen metabolizing enzyme and breast cancer risk in Thai women.
19414505 2009 CYP450 polymorphisms as risk factors for early-onset lung cancer: gender-specific differences.
19412423 2009 Polymorphisms of Metabolizing Enzymes and Susceptibility to Ethmoid Intestinal-type Adenocarcinoma in Professionally Exposed Patients.
19387820 2009 Genetic polymorphisms of FSHR, CYP17, CYP1A1, CAPN10, INSR, SERPINE1 genes in adolescent girls with polycystic ovary syndrome.
19356113 2009 Utility of Nicotiana tabacum cell suspension cultures expressing human CYP1A1, CYP1A2 and CYP3A4 to study the oxidative metabolism of the herbicide 14C-fluometuron.
19351467 2009 [Relationship between gene polymorphism of CYP2E1, CYP1A1, IL-4 and medicamentosa-like dermatitis induced by trichloroethylene].
19346634 2009 Association of CYP1A1*2 polymorphisms with breast cancer risk: a case control study.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19339270 2009 Genetic associations of 115 polymorphisms with cancers of the upper aerodigestive tract across 10 European countries: the ARCAGE project.
19338043 2009 Genetic polymorphisms in glutathione S-transferases and cytochrome P450s, tobacco smoking, and risk of non-Hodgkin lymphoma.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19317600 2008 Polymorphism of CYP1A1*2C, GSTM1*0, and GSTT1*0 in a Mexican Mestizo population: a similitude analysis.
19307236 2009 Aromatic DNA adducts and polymorphisms in metabolic genes in healthy adults: findings from the EPIC-Spain cohort.
19303595 2009 Negative effects of serum p,p'-DDE on sperm parameters and modification by genetic polymorphisms.
19290787 2009 Novel DNA sequence variations of cytochrome P450 genes in the Han Chinese population.
19287966 2009 CYP1B1, but not CYP1A1, is downregulated by promoter methylation in colorectal cancers.
19285097 2009 CYP1A1 and CYP1A2 expression: comparing 'humanized' mouse lines and wild-type mice; comparing human and mouse hepatoma-derived cell lines.
19276377 2009 CYP1A1/2 haplotypes and lung cancer and assessment of confounding by population stratification.
19267064 2009 [Relationship between genetic polymorphisms of phase I and phase II metabolizing enzymes and DNA damage of workers exposed to vinyl chloride monomer].
19252926 2009 Polymorphisms of CYP1A1 and GSTM1 and laryngeal cancer risk: evidence-based meta-analyses.
19246429 2009 Polymorphisms in metabolic genes CYP1A1 and GSTM1 and changes in maternal smoking during pregnancy.
19229255 2009 Genetic polymorphisms in estrogen metabolism and breast cancer risk in case-control studies in Japanese, Japanese Brazilians and non-Japanese Brazilians.
19222528 2009 Phase I and II enzyme polymorphisms as risk factors for Barrett's esophagus and esophageal adenocarcinoma: a systematic review and meta-analysis.
19219744 2009 Acetaminophen bioactivation by human cytochrome P450 enzymes and animal microsomes.
19178087 2008 [Analysis of the cytochrome P450 (CYP1A1) gene polymorphism in the ethnic groups of the Republic of Bashkortostan].
19174490 2009 Tobacco and estrogen metabolic polymorphisms and risk of non-small cell lung cancer in women.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19160101 2009 CYP1A1 and GSTM1 polymorphisms and oral cancer risk: association studies via evidence-based meta-analyses.
19147266 2009 A case-control study of CYP1A1, GSTT1 and GSTM1 gene polymorphisms, pregnancy smoking and fetal growth restriction.
19143007 2009 Quantification of phase I/II metabolizing enzyme gene expression and polycyclic aromatic hydrocarbon-DNA adduct levels in human prostate.
19138996 2008 Heat shock protein 90 inhibitors suppress aryl hydrocarbon receptor-mediated activation of CYP1A1 and CYP1B1 transcription and DNA adduct formation.
19127255 2009 Validating genetic risk associations for ovarian cancer through the international Ovarian Cancer Association Consortium.
19126602 2009 Expression of CYP1A1 and CYP1B1 in human endothelial cells: regulation by fluid shear stress.
19110417 2009 Common genetic variations of the cytochrome P450 1A1 gene and risk of hepatocellular carcinoma in a Chinese population.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19070657 2009 CYP1A1 induction and CYP3A4 inhibition by the fungicide imazalil in the human intestinal Caco-2 cells-comparison with other conazole pesticides.
19064581 2008 Lack of association between the functional polymorphisms in the estrogen-metabolizing genes and risk for hepatocellular carcinoma.
19031960 Association between genetic polymorphisms and ovarian cancer risk.
19024313 2008 [Using MSR model to analyze the impact of gene-gene interaction with related to the genetic polymorphism of metabolism enzymes on the risk of breast cancer].
19022366 2009 Relation of PON1 and CYP1A1 genetic polymorphisms to clinical findings in a cross-sectional study of a Greek rural population professionally exposed to pesticides.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
19013013 2009 Sulforaphane induces CYP1A1 mRNA, protein, and catalytic activity levels via an AhR-dependent pathway in murine hepatoma Hepa 1c1c7 and human HepG2 cells.
19012698 2008 Cigarette smoking and glutathione S-transferase M1 polymorphism associated with risk for uterine cervical cancer.
19009239 2009 Lung cancer risk in north Indian population: role of genetic polymorphisms and smoking.
18992263 2009 Colon tumor mutations and epigenetic changes associated with genetic polymorphism: insight into disease pathways.
18990750 2008 Red meat intake, doneness, polymorphisms in genes that encode carcinogen-metabolizing enzymes, and colorectal cancer risk.
18990008 Effect of genetic predisposition on the risk of gallbladder cancer in Hungary.
18980759 2010 Polymorphisms of estrogen-related genes jointly confer susceptibility to human spermatogenic defect.
18979064 2009 Association between polymorphisms in the biometabolism genes CYP1A1, GSTM1, GSTT1 and GSTP1 in bladder cancer.
18941913 2009 Coffee intake, variants in genes involved in caffeine metabolism, and the risk of epithelial ovarian cancer.
18936436 2009 Prevalence in the United States of selected candidate gene variants: Third National Health and Nutrition Examination Survey, 1991-1994.
18849443 2008 Elevated expression of CYP1A1 and gamma-SYNUCLEIN in human ectopic (ovarian) endometriosis compared with eutopic endometrium.
18824009 2008 Regulation of cytochrome P4501A1 expression by hyperoxia in human lung cell lines: Implications for hyperoxic lung injury.
18819424 [Associations of the genotypes of the CYP1A1 gene with predisposition to hydatid disease caused by Echinococcus granulosus strain G1].
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18800292 2008 Evaluation of primary DNA damage, cytogenetic biomarkers and genetic polymorphisms for CYP1A1 and GSTM1 in road tunnel construction workers.
18798002 2009 Coffee consumption, genetic susceptibility and bladder cancer risk.
18784359 2008 Polymorphisms in phase I and phase II metabolism genes and risk of chronic benzene poisoning in a Chinese occupational population.
18779756 Relationship between single nucleotide polymorphisms in CYP1A1 and CYP1B1 genes and the bone mineral density and serum lipid profiles in postmenopausal Japanese women taking hormone therapy.
18774560 2009 Association of CYP1A1 and glutathione S-transferase polymorphisms with male factor infertility.
18768509 2008 Genetic variation in genes for the xenobiotic-metabolizing enzymes CYP1A1, EPHX1, GSTM1, GSTT1, and GSTP1 and susceptibility to colorectal cancer in Lynch syndrome.
18767181 2008 CYP1A1 polymorphisms and the risk of upper aerodigestive tract cancers in an Indian population.
18763031 2008 CYP1A1 and CYP1B1 genetic polymorphisms and uterine leiomyoma risk in Chinese women.
18706519 2008 GSTM1 polymorphism along with PM10 exposure contributes to the risk of preterm delivery.
18700132 2008 Involvement of CREM in CYP1A1 induction through ligand-independent activation pathway of aryl hydrocarbon receptor in HepG2 cells.
18698632 2008 Genetic susceptibilities in the association between maternal exposure to tobacco smoke and the risk of nonsyndromic oral cleft.
18691756 2009 Paternal smoking, genetic polymorphisms in CYP1A1 and childhood leukemia risk.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18642288 2008 Case-control study of oral and oropharyngeal cancer in whites and genetic variation in eight metabolic enzymes.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18632753 2008 Bladder cancer risk and genetic variation in AKR1C3 and other metabolizing genes.
18628428 2008 Polymorphisms in genes involved in sex hormone metabolism, estrogen plus progestin hormone therapy use, and risk of postmenopausal breast cancer.
18618215 2008 Genetic polymorphisms in oestrogen metabolic pathway and breast cancer: a positive association with combined CYP/GST genotypes.
18601742 2008 Polymorphisms of selected xenobiotic genes contribute to the development of papillary thyroid cancer susceptibility in Middle Eastern population.
18593984 2008 Increased prevalence of EGFR-mutant lung cancer in women and in East Asian populations: analysis of estrogen-related polymorphisms.
18590468 2008 Relevance of glutathione S-transferase M1 and cytochrome P450 1A1 genetic polymorphisms to the development of head and neck cancers.
18589596 2008 [Polymorphisms of GSTM1, GSTT1 and CYP1A1 genes in mothers and neonates related to susceptibility to preterm delivery].
18577398 2008 CYP1A1 Ile462Val and GSTT1 modify the effect of cord blood cotinine on neurodevelopment at 2 years of age.
18569591 2008 Head and neck squamous-cell cancer and its association with polymorphic enzymes of xenobiotic metabolism and repair.
18550589 2008 Evaluation of genetic damage in a Brazilian population occupationally exposed to pesticides and its correlation with polymorphisms in metabolizing genes.
18510611 2008 Screening of 214 single nucleotide polymorphisms in 44 candidate cancer susceptibility genes: a case-control study on gastric and colorectal cancers in the Japanese population.
18507060 Genetic polymorphisms of carcinogen metabolizing enzymes are associated with oral leukoplakia development and p53 overexpression.
18507050 Lack of association among polymorphic xenobiotic-metabolizing enzyme genotypes and the occurrence and progression of oral carcinoma in a Brazilian population.
18497059 2008 Comparative analysis of SNP in estrogen-metabolizing enzymes for ovarian, endometrial, and breast cancers in Novosibirsk, Russia.
18496222 2008 Meta-analysis and pooled analysis of GSTM1 and CYP1A1 polymorphisms and oral and pharyngeal cancers: a HuGE-GSEC review.
18495522 2008 Cytogenetic effects induced by Prestige oil on human populations: the role of polymorphisms in genes involved in metabolism and DNA repair.
18493746 2008 Pharmacologic profiling of human and rat cytochrome P450 1A1 and 1A2 induction and competition.
18463401 2008 CYP1A1, GSTM1, and GSTT1 polymorphisms, smoking, and lung cancer risk in a pooled analysis among Asian populations.
18449058 2008 Maternal smoking and oral clefts: the role of detoxification pathway genes.
18447907 2008 Influence of genetic factors on toluene diisocyanate-related symptoms: evidence from a cross-sectional study.
18437510 2008 Passive smoking, cytochrome P450 gene polymorphisms and dysmenorrhea.
18415801 2008 Combined effect of GSTM1, GSTT1 and GSTP1 polymorphisms on histological subtypes of lung cancer.
18415690 2008 Genetic variation in hormone metabolizing genes and risk of testicular germ cell tumors.
18414197 2008 Genetic polymorphisms of metabolic enzymes CYP1A1, CYP2D6, GSTM1 and GSTT1 and leukemia susceptibility.
18409147 CYP1A1 *2B and *4 polymorphisms are associated with lung cancer susceptibility in Mexican patients.
18409146 Relationship between genetic polymorphism of CYP1A1 at codon 462 (Ile462Val) in colorectal cancer.