Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.02
PubTator Score 3.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
ductal carcinoma in situ -1.400 4.8e-04
glioblastoma 1.100 1.7e-04
interstitial cystitis 1.500 3.2e-04
intraductal papillary-mucinous carcinoma... -1.100 1.3e-03
intraductal papillary-mucinous neoplasm ... -1.100 7.8e-03
invasive ductal carcinoma -1.600 1.7e-03
lung adenocarcinoma -1.100 4.2e-12
lung cancer -1.100 1.0e-03
medulloblastoma, large-cell 1.200 1.5e-04
non-small cell lung cancer -1.151 6.7e-16
ovarian cancer 1.100 5.3e-12

Gene RIF (1)

AA Sequence

MEPQLGPEAAALRPGWLALLLWVSALSCSFSLPASSLSSLVPQVRTSYNFGRTFLGLDKCNACIGTSICK      1 - 70
KFFKEEIRSDNWLASHLGLPPDSLLSYPANYSDDSKIWRPVEIFRLVSKYQNEISDRRICASASAPKTCS     71 - 140
IERVLRKTERFQKWLQAKRLTPDLVQGLASPLLRCPSQRLLDRVVRRYAEVADAGSIFMDHFTDRDKLRL    141 - 210
LYTLAVNSHPILLQIFPGAEGWPLPKYLGSCGRFLVSTSTRPLQEFYDAPPDQAADLAYQLLGVLESLRS    211 - 280
NDLNYFFYFTHIDAGMFGVFNNGHLFIRDASAVGVIDKQEGSQEANRAGENKDIFSCLVSGCQAQLPSCE    281 - 350
SISEKQSLVLVCQKLLPRLLQGRFPSPVQDDIDSILVQCGDSIRPDPEVLGAASQLKDILRPLRTCDSRF    351 - 420
AYRYPDCKYNDKF                                                             421 - 433
//

Text Mined References (14)

PMID Year Title