Property Summary

NCBI Gene PubMed Count 154
PubMed Score 923.75
PubTator Score 395.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (23)

Disease log2 FC p
psoriasis 3.500 8.4e-04
interstitial cystitis 3.200 4.2e-02
active Crohn's disease 1.518 4.0e-03
adult high grade glioma 1.500 1.1e-03
atypical teratoid / rhabdoid tumor 1.500 9.4e-03
Breast cancer 2.500 9.8e-05
breast carcinoma 1.500 1.3e-02
COPD -2.200 1.3e-02
cutaneous lupus erythematosus 5.300 1.5e-04
glioblastoma 1.300 2.8e-03
head and neck cancer and chronic obstruc... 2.200 4.8e-02
intraductal papillary-mucinous carcinoma... -1.600 1.3e-02
invasive ductal carcinoma 2.016 1.9e-03
juvenile dermatomyositis 1.510 2.4e-04
lung adenocarcinoma 1.300 3.0e-04
lung carcinoma -1.500 3.0e-04
medulloblastoma, large-cell 1.200 9.9e-04
mucosa-associated lymphoid tissue lympho... 2.594 4.8e-02
nasopharyngeal carcinoma 2.400 9.4e-05
non primary Sjogren syndrome sicca 1.700 4.4e-03
non-small cell lung carcinoma 1.200 1.7e-06
sarcoidosis 3.200 1.8e-02
ulcerative colitis 2.800 1.3e-04

Protein-protein Interaction (1)

Gene RIF (129)

AA Sequence

MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNG      1 - 70
VQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT                    71 - 125
//

Text Mined References (154)

PMID Year Title