Property Summary

NCBI Gene PubMed Count 144
PubMed Score 860.56
PubTator Score 395.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (22)

Disease log2 FC p
interstitial cystitis 3.200 4.2e-02
cutaneous lupus erythematosus 5.300 1.5e-04
psoriasis 3.700 1.7e-99
COPD -2.200 1.3e-02
atypical teratoid / rhabdoid tumor 1.500 9.4e-03
glioblastoma 1.300 2.8e-03
medulloblastoma, large-cell 1.200 9.9e-04
juvenile dermatomyositis 1.510 2.4e-04
intraductal papillary-mucinous carcinoma... -1.600 1.3e-02
active Crohn's disease 1.518 4.0e-03
sarcoidosis 3.200 1.8e-02
breast carcinoma 1.800 3.4e-22
lung adenocarcinoma 1.400 1.2e-02
adult high grade glioma 1.500 1.1e-03
primary Sjogren syndrome 3.800 7.4e-06
invasive ductal carcinoma 4.100 1.3e-03
nasopharyngeal carcinoma 2.400 9.4e-05
inflammatory breast cancer 3.200 8.3e-03
lung carcinoma -1.500 3.0e-04
non-small cell lung carcinoma 1.200 1.7e-06
mucosa-associated lymphoid tissue lympho... 2.594 4.8e-02
ulcerative colitis 2.800 1.3e-04

Synonym

Accession Q07325 Q503B4
Symbols CMK
MIG
Humig
SCYB9
crg-10

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (118)

PMID Text
26898419 CXCL9 is a useful predictor of better clinical outcome in colorectal cancer patients.
26828996 The mRNA expression and serum levels of CXCL9 were both increased.
26564003 Data show that asymptomatic patients with unstable plaques exhibited higher levels of endothelial microparticles (EMPs), CXCL9 chemokine and stem cell growth factor; lymphocyte secreted C-type lectin (SCGF-beta) compared to those with stable plaques.
26506526 congruent with the concept that inflammation plays a key role in the pathogenesis of LV dysfunction, MIG, IP10 and I-TAC add diagnostic accuracy over and beyond NT-pro BNP.
26268659 This paper suggests a role for Epithelial to mesenchymal cell transition in the pathogenesis of idiopathic pulmonary fibrosis and provides a novel mechanism for the inhibitory effects of CXCL9 on TGF-beta1-induced Epithelial to mesenchymal cell transition.
25972108 This work confirms that OPN, CCL5 and CXCL9 plasma levels are higher in psoriasis patients and provides evidence that their higher levels are not a consequence of obesity.
25950774 Suggest that CD44 and CXCL9 may serve as predictive biomarkers to identify liver allograft recipients at risk for clinically significant acute graft rejection.
25890876 This inhibitory action of resveratrol was also observed for the cytokines-induced expression of chemokines CXCL9, CCL2 and CCL5.
25713416 These findings functionally integrate K17, hnRNP K, and gene expression along with RSK and CXCR3 signaling in a keratinocyte-autonomous axis and provide a potential basis for their implication in tumorigenesis
25702175 There were no significant differences in distribution of CXCL9 genotypes and alleles between rheumatoid arthritis patients and control group.
25559603 The homozygosity for the CXCL9 rs10336 (T), CXCL10 rs3921 (G), and CXCL11 rs4619915 (A) alleles is associated with the higher likelihood of significant liver fibrosis in HIV-infected patients coinfected with hepatitis C virus genotype 1.
25528189 The expression of TNF-alpha and CXCL9 in blood samples stimulated with a bacterial antigen distinguishes active tuberculosis patients from latent disease carriers and healthy controls.
25422100 Elevated IL-2R, IL-1RA, and CXCL9 are associated with shorter event-free survival in newly diagnosed follicular lymphoma, treated with chemoimmunotherapy.
25398650 CXCL9 inhibits the proliferation of epithelial cells via phosphorylation of p70S6K, resulting in the excretion of TGF-beta as downstream mediator. CXCL9/CXCR3 interaction can exacerbate antineoplastic agent-induced intestinal damage.
25151370 CXCL9 is involved in the invasion ability of hepatocellular carcinoma cells possibly through up-regulation of its potential effector PREX2.
25115612 both bactericidal and cell-recruiting activities of MIG/CXCL9 are corrupted by P. aeruginosa through release of elastase, and this may contribute to impaired airway host defense in CF.
24742347 HIV-1 and the viral protein Tat modulate the expression of chemokine (C-X-C motif) ligand 9 (CXCL9; HuMIG) in immature dendritic cells and monocyte-derived macrophages
24614402 Knock-down of CD44 resulted in an upregulation of mRNA expression of the chemokines CXCL9 and CXCL12, as well as their receptors CXCR3 and CXCR4.
24600982 Results also showed that the circulating levels of CXCL9 and CXCL10 were decreased in SCD patients in comparison to control subjects
24438589 CXCL9 expression was low in control skin, mild in perilesional skin from slowly progressive vitiligo and high in progressive vitiligo. Such expression was found in the epidermal as well as the dermal infiltrate.
24363401 Plasma concentrations of CXCL9 are elevated at the onset of chronic graft-versus-host disease diagnosis, but not in patients with chronic graft-versus-host disease for more than 3 months.
24351073 Higher circulating levels of CXCL-9 and -11 have been shown in non-pregnant autoimmune thyroiditis patients with a history of recurrent abortion as compared to both control groups
24278236 study demonstrated that CXCL9 is associated with tumor burden and aggressiveness of NPC tumors and the serum level of this ligand may be useful as a prognostic indicator
24124595 CXCL9 associated with sustained virological response in chronic hepatitis B patients receiving peginterferon alfa-2a therapy.
24084359 In this study of human cryoglobulinemic glomerulonephritis we showed a striking expression of cytokine CXCL9, a classical macrophage activation marker, by the macrophages and possibly other cell types within the glomeruli.
24063316 CXCL9 was increased in lung transplant lavage fluid during diffuse alveolar damage, acute rejection, and lymphocytic bronchiolitis. Elevated CXCL9 was associated with increased risk of chronic allograft dysfunction.
23975214 Data suggest serum levels of CXCL9/CXCL10 at diagnosis of LAHS (non-Hodgkin lymphoma-associated hemophagocytic syndrome) are elevated; successful treatment decreases levels; CXCL9/CXCL10 levels are useful for diagnosis/therapeutic outcomes in LAHS.
23968332 High urinary CXCL9 is associated with kidney transplant injury.
23902475 Increased CXCL9 serum levels in hepatitis C-related mixed cryoglobulinemia, with autoimmune thyroiditis, associated with high levels of CXCL10.
23769451 Our study demonstrated that CXCL9 is associated with tumor burden and aggressiveness of OSCC tumors and serum level of this ligand may be useful as a prognostic indicator
23600831 CXCR3 ligands CXCL10, CXCL9 and CXCL11 were measured in 245 children with opsoclonus-myoclonus syndrome and 81 controls.
23535064 HIV-1 and the viral protein Tat modulate the expression of chemokine (C-X-C motif) ligand 9 (CXCL9; HuMIG) in immature dendritic cells and monocyte-derived macrophages
23527708 Our study demonstrates in mixed cryoglobulinemia and hepatitis C vs controls: (i)high serum CXCL9 and CXCL11, significantly associated with the presence of active vasculitis; (ii) a strong relationship between circulating CXCL9 and CXCL11
23502337 increased serum levels in patients with alopecia areata
23417848 Collectively, our results show that a diverse milieu of chemokines is expressed in myocardium and valvular tissue lesions and emphasize the role of CXCL9/Mig in mediating T cell recruitment to the site of inflammation in the heart.
23383108 HIV-1 and the viral protein Tat modulate the expression of chemokine (C-X-C motif) ligand 9 (CXCL9; HuMIG) in immature dendritic cells and monocyte-derived macrophages
23352833 This study aimed at examining the presence and role of chemokines (angiogenic CCL2/MCP-1 and angiostatic CXCL4/PF-4, CXCL9/Mig, CXCL10/IP-10) in proliferative diabetic retinopathy.
23179902 The secretion of CXCL9 by activated T cells is also increasingly downregulated with increasing concentrations of bortezomib.
23150742 These results may suggest that CXCL9 and CXCL10 are master regulators of myocardial inflammatory cell migration, perhaps affecting clinical progression to the life-threatening form of chronic Chagas cardiomyopathy.
23012327 In chronic graft-vs-host disease, increased levels of the Th1-associated chemokines CXCL9, CXCL10, and CXCL11 led to recruitment of CXCR3+ T cells from the peripheral blood into affected tissues.
22905138 CXCL9/10 have antifibrotic roles on liver non-parenchymal cells
22889476 Intragraft CXCL9 mRNA has a functionally important role in T-cell activation in liver allograft and serves as biomarker for acute cellular rejection.
22766105 Report high serum levels of CXCL9/TNF-alpha/interferon-gamma in patients with mixed cryoglobulinaemia and chronic hepatitis C.
22689822 Malaria-infected primigravidae with placental CXCL9 levels in the lowest tertile gave birth to babies who weighed 610 g more than babies born to mothers with high CXCL9 levels.
22586042 HSV-2 induces CXCL9 expression in human cervical epithelial cells by activation of p38-C/EBP-beta pathway
22580676 Autophagy may be a crucial intracellular mechanism of Mig induction in response to HBV infection.
22467521 Elevated plasma levels of MIG are associated with inflammatory bowel disease with JCV infection.
22401175 Immunohistochemically, the lining synovium of Rheumatoid Aarthritis clearly expressed CXCL9
22367045 Expression of CXCL9, -10, and -11 chemokines and their receptor CXCR3 increases in the aqueous humor of patients with herpetic endotheliitis.
22333315 CXCL9 is localized predominantly in the cytoplasm of breast cancer cells and prostaglandin E2 inhibits cytokine induced CXCL9 secretion.
22037980 Significantly higher levels of chemokines CCL2, CXCL8, CXCL9 and CXCL10 are found in hematoma fluid compared with serum.
21962843 Elevated plasma levels of interferon-gamma and Cys-X-Cys chemokine receptor 3-binding chemokine CXCL9 are present in patients with thoracic aortic aneurysms.
21812928 We found that urine CXCL9 and CXCL10 were markedly elevated in adults and children experiencing either AR or BKI (p = 0.0002), but not in stable allograft recipients
21645215 CXCR3 ligands, CXCL9,10,11, are differentially expressed during chronic liver diseases across different disease stages and aetiologies.
21601475 Data show circulating CXCL9, in association with CXCL10, levels were clearly elevated in autoimmune thyroiditis patients.
21475065 Letter: Pretransplant serum CXCL9 levels failed to predict acute rejection in patients receiving basiliximab or alemtuzumab induction therapy.
21470996 We first show that circulating CXCL9 and CXCL11 are increased in patients with thyroiditis and hypothyroidism and are related to each other.
21303517 These results show that while the expression of MIG/CXCL9 and IP-10/CXCL10 are elevated in Systemic sclerosis (SSc) serum, the expression of CXCR3 is downregulated on SSc dermal Endothelial cells.
21179030 CXCL9 expressed by tumour stroma cells promotes the escape of the melanoma cells from tumour metastases.
21167783 Mycobacterium tuberculosis increases IP-10 and MIG protein despite inhibition of IP-10 and MIG transcription.
20942936 HIV-1 and the viral protein Tat modulate the expression of chemokine (C-X-C motif) ligand 9 (CXCL9; HuMIG) in immature dendritic cells and monocyte-derived macrophages
20838432 Expression of MIG mRNA after vaccination correlated inversely with malaria vaccine immunogenicity.
20810571 A potent dose-dependent inhibition by PPARalpha-agonists was observed on the cytokines-stimulated secretion of CXCL9 in Graves disease and in primary thyrroid culture.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20626297 predominant expression in the brain during chronic infection with Toxoplasma gondii is dependent on interferon-gamma
20503287 Observational study of gene-disease association. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
20456109 CXCL9 may have a role in acute rejection and graft failure risk in kidney transplantation [commentary]
20299237 The effect of IFNalpha, IFNbeta and IFNgamma on the secretion of the Th1 chemokines CXCL9 and CXCL10, in primary cultures of human thyroid follicular cells and to assess the effect of PPARgamma activation on CXCL9 and CXCL10 secretion, were tested.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20137825 CXCL-9 and CXCL-10 play a major role in the development of hepatic flares. Their differential expression in acute versus chronic patients suggests the presence of different mechanisms that govern liver injury during acute and chronic hepatitis B.
20038462 Data demonstrate that CXCL9 has immunomodulatory functions that are not mediated through a G-protein coupled receptor and may possess additional roles in host defenses against infection.
19929857 CXCL9 may have a role in acute rejection and graft failure in kidney graft recipients
19898927 higher expression in the genital mucosa than in the blood of HIV-1-infected women from Benin
19800124 The three-dimensional structure of CXCL9 and CXCR3, and, successively, of the CXCL9/CXCR3 complex were modelled in comparison to CXCL10/CXCR3 and CXCL11/CXCR3 complexes.
19639049 Significantly lower serum concentration of CXCL-9, CXCL-10, CCL-17, and IL-18 and higher concentration of CXCL-12 and CCL-27 were found in atopic dermatitis patients under 10 years old when compared to Control.
19565490 There are disease-specific associations between anti-Jo-1 antibody-positive interstitial lung disease and serum levels of CRP as well as the interferon-gamma-inducible chemokines CXCL9 and CXCL10.
19459809 urinary CXCL9 and CXCL10 concentrations demonstrated a close correlation with the extent of subclinical tubulitis, while no such distinction was seen for urinary CXCL4, CXCL11, CCL2 and tubular injury markers.
19410617 Although data did not find an association of the CXCL9 and CXCL10 polymorphisms with type 1 diabetes in the German population, it cannot discard their role in other populations or other autoimmune diseases.
19410617 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19344719 Report antifibrotic effects of CXCL9 and its receptor CXCR3 in livers of mice and humans.
19340290 positive correlation between ESAT6-induced IFNgamma and CXCL9 was present in all TB patients, but IFNgamma and CCL2 was only correlated in LNTB
19274094 SpeB destroys most of the signaling and antibacterial properties of chemokines expressed by an inflamed epithelium.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19258635 Observational study of gene-disease association. (HuGE Navigator)
19157479 HBx protein induced MIG expression in a dose-dependent manner
19134328 The interactions between CXCL9, CXCL10 and CXCL12 expressed in decidua and villi and CXCR3, CXCR4 expressed in CD(56)(+) decidua NK cells may influence the CD(56)(+)NK cell recruitment at the maternal-fetal interface.
19087608 COMP, CXCL9 and KRT19 play an important role in the pathopoiesis of oral submucosal fibrosis.
18930766 plasma levels are significantly higher in Alzheimer's disease patients
18415893 Graves' disease patients who relapsed or went into remission had significantly different levels of CXCL9.
18413205 primary renal disease showed significant increased levels of urinary CXCL8 and CXCL9 compared to controls
18338951 finding a constitutive expression of MIG/CXCL9 in the male urogenital tracts suggests roles for this chemokine both in host defense and during early phases of fertilization
18292502 Inflammatory chemokine CXCL9 triggers lymphocyte function-associated antigen-1 (LFA-1) adhesiveness in a RhoA-independent manner and without triggering integrin extension.
17975089 In summary, both GGS (Streptococcus dysgalactiae subsp. equisimilis) and GAS (Streptococcus pyogenes) evoke MIG/CXCL9 expression but they differ in susceptibility to its antibacterial effects.
17892861 Observational study of gene-disease association. (HuGE Navigator)
17892861 Data may contribute to a better understanding of the pathophysiology underlying Crohn's disease.
17875534 serum IP-10 and MIG levels were significantly higher in lymphoproliferative disease of granular lymphocytes patients than in healthy donors, and MIG expression was associated with the number of circulating LGLs
17703412 Observational study of gene-disease association. (HuGE Navigator)
17703315 During treatment of ulceretive colitis with corticosteroids CXCL1/CXCL9 were decreased.
17490641 Data suggest atherosclerotic inflammation may be a trigger for sclerosis in calcified stenotic aortic valves through upregulation TGF-beta, VAP-1, MIG and Eotaxin3, which is only partially inhibited by previous statin therapy.
17262710 A novel innate defense mechanism against invasive bacteria on epithelial surfaces is reported in pharyngeal cells expressing.
17255201 prolactin may enhance IFN-gamma-induced CXCL9, CXCL10, and CXCL11 production in keratinocytes
16583210 Both a Th1 chemoattractant (CXCL9) and Th2 chemoattractants, CCL17 and CCL22, cooperatively play a role in the development of autoimmune blistering disease.
16243485 Increased plasma monokine induced by gamma interferon (MIG) levels in daughters and sisters of primary biliary cirrhosis (PBC) patients demonstrates involvement of MIG interaction with its receptor CXCR3 as a familial risk factor for PBC.
16210647 This CXCR3 ligand has the ability to activate biochemical (e.g., PtdIns 3-kinase and MAP kinase activation) and functional events (actin reorganization) in intestinal myofibroblasts.
16200621 Increased expression of the interferon-induced angiostatic ELR- CXC chemokines is a feature of juvenile DM that parallels the degree of vasculopathy in patients with the disease
15150261 CXCL9, CXCL10, and CXCL11 functions are mediated by intracellular domains of CXCR3
15113590 Serum Mig levels in atopic dermatitis patients were significantly higher than those in control subjects
15081261 The chemokine CXCL9, usually associated with Th1 cells, is elevated in serum of patients with acute Syndenham's chorea.
14550288 MIG and IP-10 are cleaved by gelatinase B and neutrophil collagenase
14507644 Peak of expression of CXCL9 and CXCL10 occurred 4 days before CD8+ T cells infiltrated infected tissues. CXCL9 and CXCL10 may play role early during immune response against rickettsial infections.
12946268 Constitutive NF-kappaB activity is required for the induced gene expression of CXCL9 in tumour cell lines in response to IFNgamma.
12884299 CCR3 functional responses are regulated by both CXCR3 and its ligands CXCL9, CXCL10 and CXCL11.
12847282 A higher amount of MIG mRNA is expressed after exposure of keratinocytes to interferon-gamma, leading to migration of T cells from the dermis to the epidermis and representing a second step of chemotaxis following T cell recruitment from blood.
12539042 HIV-1 and the viral protein Tat modulate the expression of chemokine (C-X-C motif) ligand 9 (CXCL9; HuMIG) in immature dendritic cells and monocyte-derived macrophages
12384933 that IFNgamma stimulates the production of IP-10 and Mig in the SS ductal epithelium, and that IP-10 and Mig are involved in the accumulation of T cell infiltrates in the Sjogren syndrome salivary gland.
12270371 Gene expression is predictive for the individual response of children with chronic allograft nephropathy to mycophenolate mofetil.
12162873 The IFN-gamma inducible MIG protein behaves as a homing chemokine constitutively expressed in human brain microvascular endothelial cells and astrocytes.

AA Sequence

MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNG      1 - 70
VQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT                    71 - 125
//

Text Mined References (144)

PMID Year Title
26898419 2016 The chemokine CXCL9 expression is associated with better prognosis for colorectal carcinoma patients.
26828996 2016 CXCL9 expression and polyomavirus BK infectivity in renal transplant patients with nephropathy.
26564003 2015 Elevated levels of endothelial-derived microparticles, and serum CXCL9 and SCGF-? are associated with unstable asymptomatic carotid plaques.
26506526 2015 Left Ventricular Dysfunction and CXCR3 Ligands in Hypertension: From Animal Experiments to a Population-Based Pilot Study.
26268659 2015 CXCL9 Regulates TGF-?1-Induced Epithelial to Mesenchymal Transition in Human Alveolar Epithelial Cells.
25972108 2015 Osteopontin, CCL5 and CXCL9 are independently associated with psoriasis, regardless of the presence of obesity.
25950774 2015 CD44 and CXCL9 serum protein levels predict the risk of clinically significant allograft rejection after liver transplantation.
25890876 2015 Resveratrol attenuates CXCL11 expression induced by proinflammatory cytokines in retinal pigment epithelial cells.
25713416 2015 Regulation of C-X-C chemokine gene expression by keratin 17 and hnRNP K in skin tumor keratinocytes.
25702175 2015 CXCL9 and CXCL10 gene polymorphisms in patients with rheumatoid arthritis.
25559603 2015 Single nucleotide polymorphisms of CXCL9-11 chemokines are associated with liver fibrosis in HIV/HCV-coinfected patients.
25528189 2015 Diagnostic performance of a cytokine and IFN-?-induced chemokine mRNA assay after Mycobacterium tuberculosis-specific antigen stimulation in whole blood from infected individuals.
25422100 2015 Elevated serum levels of IL-2R, IL-1RA, and CXCL9 are associated with a poor prognosis in follicular lymphoma.
25416956 2014 A proteome-scale map of the human interactome network.
25398650 2015 The chemokine CXCL9 exacerbates chemotherapy-induced acute intestinal damage through inhibition of mucosal restitution.
25151370 2014 The effect of CXCL9 on the invasion ability of hepatocellular carcinoma through up-regulation of PREX2.
25115612 2014 Expression of MIG/CXCL9 in cystic fibrosis and modulation of its activities by elastase of Pseudomonas aeruginosa.
24614402 2014 Knock-down of CD44 regulates endothelial cell differentiation via NF?B-mediated chemokine production.
24600982 2014 CXC chemokines CXCL1, CXCL9, CXCL10 and CXCL12 are variably expressed in patients with sickle cell disease and carriers: are they predictive tools for disease complications?
24438589 2014 Type I interferon signature in the initiation of the immune response in vitiligo.
24363401 2014 Plasma CXCL9 elevations correlate with chronic GVHD diagnosis.
24351073 2014 Higher levels of circulating CXCL-9 and CXCL-11 in euthyroid women with autoimmune thyroiditis and recurrent spontaneous abortions.
24278236 2013 Serum CXCL9 levels are associated with tumor progression and treatment outcome in patients with nasopharyngeal carcinoma.
24124595 2013 CXCL9 associated with sustained virological response in chronic hepatitis B patients receiving peginterferon alfa-2a therapy: a pilot study.
24084359 2013 Expression of macrophage markers in cryoglobulinemic glomerulonephritis - a possible role of CXCL9.
24063316 2013 CXCR3 ligands are associated with the continuum of diffuse alveolar damage to chronic lung allograft dysfunction.
23975214 2014 IP-10/CXCL10 and MIG/CXCL9 as novel markers for the diagnosis of lymphoma-associated hemophagocytic syndrome.
23968332 2013 Multicenter validation of urinary CXCL9 as a risk-stratifying biomarker for kidney transplant injury.
23902475 2013 Increased CXCL9 serum levels in hepatitis C-related mixed cryoglobulinemia, with autoimmune thyroiditis, associated with high levels of CXCL10.
23769451 2013 Serum levels of chemokine (C-X-C motif) ligand 9 (CXCL9) are associated with tumor progression and treatment outcome in patients with oral cavity squamous cell carcinoma.
23600831 2013 Expression of CXCR3 and its ligands CXCL9, -10 and -11 in paediatric opsoclonus-myoclonus syndrome.
23527708 High circulating chemokines (C-X-C motif) ligand 9, and (C-X-C motif) ligand 11, in hepatitis C-associated cryoglobulinemia.
23502337 2013 Differential expression of CXCL1, CXCL9, CXCL10 and CXCL12 chemokines in alopecia areata.
23417848 2013 CXCL9/Mig mediates T cells recruitment to valvular tissue lesions of chronic rheumatic heart disease patients.
23352833 2013 Autocrine CCL2, CXCL4, CXCL9 and CXCL10 signal in retinal endothelial cells and are enhanced in diabetic retinopathy.
23179902 2012 Bortezomib regulates the chemotactic characteristics of T cells through downregulation of CXCR3/CXCL9 expression and induction of apoptosis.
23150742 2012 Myocardial chemokine expression and intensity of myocarditis in Chagas cardiomyopathy are controlled by polymorphisms in CXCL9 and CXCL10.
23012327 2012 Chemokine-mediated tissue recruitment of CXCR3+ CD4+ T cells plays a major role in the pathogenesis of chronic GVHD.
22905138 2012 Gene profile of chemokines on hepatic stellate cells of schistosome-infected mice and antifibrotic roles of CXCL9/10 on liver non-parenchymal cells.
22889476 2012 Intragraft transcriptome level of CXCL9 as biomarker of acute cellular rejection after liver transplantation.
22766105 Chemokine (CXC motif) ligand 9 serum levels in mixed cryoglobulinaemia are associated with circulating levels of IFN-gamma and TNF-alpha.
22689822 2012 CXC ligand 9 response to malaria during pregnancy is associated with low-birth-weight deliveries.
22586042 2012 Herpes simplex virus type 2 infection of human epithelial cells induces CXCL9 expression and CD4+ T cell migration via activation of p38-CCAAT/enhancer-binding protein-? pathway.
22580676 2012 Role of autophagy in monokine induced by interferon ? (Mig) production during adenovirus-hepatitis B virus infection.
22467521 2012 JCV+ Patients with Inflammatory bowel disease show elevated plasma levels of MIG and SCF.
22401175 2012 Gene expression analysis of rheumatoid arthritis synovial lining regions by cDNA microarray combined with laser microdissection: up-regulation of inflammation-associated STAT1, IRF1, CXCL9, CXCL10, and CCL5.
22367045 2012 Expression of CXCL9, -10, and -11 in the aqueous humor of patients with herpetic endotheliitis.
22333315 2012 Modulation of CXCR3 ligand secretion by prostaglandin E2 and cyclooxygenase inhibitors in human breast cancer.
22037980 2012 Chemokines as markers of local inflammation and angiogenesis in patients with chronic subdural hematoma: a prospective study.
21962843 2012 Circulating interferon-?-inducible Cys-X-Cys chemokine receptor 3 ligands are elevated in humans with aortic aneurysms and Cys-X-Cys chemokine receptor 3 is necessary for aneurysm formation in mice.
21812928 2011 Urinary chemokines CXCL9 and CXCL10 are noninvasive markers of renal allograft rejection and BK viral infection.
21645215 2011 Serum chemokine receptor CXCR3 ligands are associated with progression, organ dysfunction and complications of chronic liver diseases.
21601475 2011 Circulating chemokine (CXC motif) ligand (CXCL)9 is increased in aggressive chronic autoimmune thyroiditis, in association with CXCL10.
21475065 2011 Pretransplant serum CXCL9 and CXCL10 levels fail to predict acute rejection in kidney transplant recipients receiving induction therapy.
21470996 2011 Increase of circulating CXCL9 and CXCL11 associated with euthyroid or subclinically hypothyroid autoimmune thyroiditis.
21314817 2011 Neuropeptide Y, B-type natriuretic peptide, substance P and peptide YY are novel substrates of fibroblast activation protein-?.
21303517 2011 Dysregulated expression of MIG/CXCL9, IP-10/CXCL10 and CXCL16 and their receptors in systemic sclerosis.
21179030 2011 CXCL9 induces chemotaxis, chemorepulsion and endothelial barrier disruption through CXCR3-mediated activation of melanoma cells.
21167783 2011 Mycobacterium tuberculosis increases IP-10 and MIG protein despite inhibition of IP-10 and MIG transcription.
20838432 2010 MIG and the regulatory cytokines IL-10 and TGF-?1 correlate with malaria vaccine immunogenicity and efficacy.
20810571 2010 CXCL9 and CXCL11 chemokines modulation by peroxisome proliferator-activated receptor-alpha agonists secretion in Graves' and normal thyrocytes.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20626297 2010 Predominant interferon-?-mediated expression of CXCL9, CXCL10, and CCL5 proteins in the brain during chronic infection with Toxoplasma gondii in BALB/c mice resistant to development of toxoplasmic encephalitis.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20456109 2010 Pre-transplant serum level of CXCL9 as a biomarker of acute rejection and graft failure risk in kidney transplantation.
20299237 2010 Interferon-alpha, -beta and -gamma induce CXCL9 and CXCL10 secretion by human thyrocytes: modulation by peroxisome proliferator-activated receptor-gamma agonists.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20137825 2010 A longitudinal analysis of innate and adaptive immune profile during hepatic flares in chronic hepatitis B.
20038462 2010 G-protein-coupled receptor independent, immunomodulatory properties of chemokine CXCL9.
19929857 2010 High pretransplant serum levels of CXCL9 are associated with increased risk of acute rejection and graft failure in kidney graft recipients.
19898927 2010 Chemokine expression patterns in the systemic and genital tract compartments are associated with HIV-1 infection in women from Benin.
19800124 2009 Modelling of the membrane receptor CXCR3 and its complexes with CXCL9, CXCL10 and CXCL11 chemokines: putative target for new drug design.
19639049 2009 The imbalance in serum concentration of Th-1- and Th-2-derived chemokines as one of the factors involved in pathogenesis of atopic dermatitis.
19565490 2009 Characterization and peripheral blood biomarker assessment of anti-Jo-1 antibody-positive interstitial lung disease.
19459809 2009 Urinary CXCL9 and CXCL10 levels correlate with the extent of subclinical tubulitis.
19410617 2009 Polymorphisms of CXCR3-binding chemokines in type 1 diabetes.
19344719 2009 Antifibrotic effects of CXCL9 and its receptor CXCR3 in livers of mice and humans.
19340290 2009 ESAT6-induced IFNgamma and CXCL9 can differentiate severity of tuberculosis.
19274094 2009 SpeB of Streptococcus pyogenes differentially modulates antibacterial and receptor activating properties of human chemokines.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19258635 2009 Association of cytokine and chemokine gene polymorphisms with severe acute respiratory syndrome.
19157479 2009 HBx protein induces expression of MIG and increases migration of leukocytes through activation of NF-kappaB.
19134328 2008 [Expression and significance of chemokine CXC receptor 3, 4 and their ligands at the early pregnancy decidua and villi].
19087608 2008 [Expression and significance of cartilage oligomeric matrix protein, C-X-C motif 9 and keratin 19 in oral submucosal fibrosis].
18930766 2008 Bioplex analysis of plasma cytokines in Alzheimer's disease and mild cognitive impairment.
18415893 2008 Circulating chemokines in patients with autoimmune thyroid diseases.
18413205 Increased urinary levels of CXCL5, CXCL8 and CXCL9 in patients with Type 2 diabetic nephropathy.
18338951 2008 The antibacterial chemokine MIG/CXCL9 is constitutively expressed in epithelial cells of the male urogenital tract and is present in seminal plasma.
18292502 2008 RhoA is involved in LFA-1 extension triggered by CXCL12 but not in a novel outside-in LFA-1 activation facilitated by CXCL9.
18275857 2008 Stromal cell-derived factors 1alpha and 1beta, inflammatory protein-10 and interferon-inducible T cell chemo-attractant are novel substrates of dipeptidyl peptidase 8.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17975089 2007 Protein FOG is a moderate inducer of MIG/CXCL9, and group G streptococci are more tolerant than group A streptococci to this chemokine's antibacterial effect.
17892861 2007 Association of a CXCL9 polymorphism with pediatric Crohn's disease.
17875534 2007 Close resemblance between chemokine receptor expression profiles of lymphoproliferative disease of granular lymphocytes and their normal counterparts in association with elevated serum concentrations of IP-10 and MIG.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17703315 2007 The proinflammatory CXC-chemokines GRO-alpha/CXCL1 and MIG/CXCL9 are concomitantly expressed in ulcerative colitis and decrease during treatment with topical corticosteroids.
17490641 2007 VAP-1, Eotaxin3 and MIG as potential atherosclerotic triggers of severe calcified and stenotic human aortic valves: effects of statins.
17262710 2007 The CXC chemokine MIG/CXCL9 is important in innate immunity against Streptococcus pyogenes.
17255201 2007 Prolactin enhances interferon-gamma-induced production of CXC ligand 9 (CXCL9), CXCL10, and CXCL11 in human keratinocytes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16583210 2006 Both Th1 and Th2 chemokines are elevated in sera of patients with autoimmune blistering diseases.
16243485 2005 Increased levels of chemokine receptor CXCR3 and chemokines IP-10 and MIG in patients with primary biliary cirrhosis and their first degree relatives.
16210647 2005 The chemokines CXCL9, CXCL10, and CXCL11 differentially stimulate G alpha i-independent signaling and actin responses in human intestinal myofibroblasts.
16200621 2005 Association between lack of angiogenic response in muscle tissue and high expression of angiostatic ELR-negative CXC chemokines in patients with juvenile dermatomyositis: possible link to vasculopathy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15150261 2004 Intracellular domains of CXCR3 that mediate CXCL9, CXCL10, and CXCL11 function.
15113590 2004 Both Th2 and Th1 chemokines (TARC/CCL17, MDC/CCL22, and Mig/CXCL9) are elevated in sera from patients with atopic dermatitis.
15081261 2004 Increased serum concentrations of monokine induced by interferon-gamma/CXCL9 and interferon-gamma-inducible protein 10/CXCL-10 in Sydenham's chorea patients.
14550288 2003 Carboxyterminal cleavage of the chemokines MIG and IP-10 by gelatinase B and neutrophil collagenase.
14507644 2003 Expression analysis of the T-cell-targeting chemokines CXCL9 and CXCL10 in mice and humans with endothelial infections caused by rickettsiae of the spotted fever group.
12949249 2003 Many chemokines including CCL20/MIP-3alpha display antimicrobial activity.
12946268 2003 Constitutive nuclear factor kappaB activity is required to elicit interferon-gamma-induced expression of chemokine CXC ligand 9 (CXCL9) and CXCL10 in human tumour cell lines.
12884299 2003 CCR3 functional responses are regulated by both CXCR3 and its ligands CXCL9, CXCL10 and CXCL11.
12856973 2003 Detection of interferon-gamma-inducible chemokines in human milk.
12847282 2003 A second step of chemotaxis after transendothelial migration: keratinocytes undergoing apoptosis release IFN-gamma-inducible protein 10, monokine induced by IFN-gamma, and IFN-gamma-inducible alpha-chemoattractant for T cell chemotaxis toward epidermis in atopic dermatitis.
12782716 2003 An alternatively spliced variant of CXCR3 mediates the inhibition of endothelial cell growth induced by IP-10, Mig, and I-TAC, and acts as functional receptor for platelet factor 4.
12539042 2003 HIV-1 Tat reprograms immature dendritic cells to express chemoattractants for activated T cells and macrophages.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12384933 2002 Involvement of the interferon-gamma-induced T cell-attracting chemokines, interferon-gamma-inducible 10-kd protein (CXCL10) and monokine induced by interferon-gamma (CXCL9), in the salivary gland lesions of patients with Sjögren's syndrome.
12270371 2002 Mig, IP-10, and CXCR3 gene expression is predictive for the individual response of children with chronic allograft nephropathy to mycophenolate mofetil.
12185171 2002 Expression of chemokines in cerebrospinal fluid and serum of patients with chronic inflammatory demyelinating polyneuropathy.
12162873 2002 Expression and modulation of IFN-gamma-inducible chemokines (IP-10, Mig, and I-TAC) in human brain endothelium and astrocytes: possible relevance for the immune invasion of the central nervous system and the pathogenesis of multiple sclerosis.
12107104 2002 Expression of IP-10/CXCL10 and MIG/CXCL9 in the thyroid and increased levels of IP-10/CXCL10 in the serum of patients with recent-onset Graves' disease.
11523044 2001 Inflammation in human skin: a model to study chemokine-mediated leukocyte migration in vivo.
11449350 2001 Neutrophils produce biologically active macrophage inflammatory protein-3alpha (MIP-3alpha)/CCL20 and MIP-3beta/CCL19.
11423172 2001 In vivo stability of human chemokine and chemokine receptor expression.
11422029 2001 The antipsoriatic drug dimethylfumarate strongly suppresses chemokine production in human keratinocytes and peripheral blood mononuclear cells.
11390394 2001 Kinetic investigation of chemokine truncation by CD26/dipeptidyl peptidase IV reveals a striking selectivity within the chemokine family.
11208713 2001 Regulated production of interferon-inducible T-cell chemoattractants by human intestinal epithelial cells.
11157474 2001 Interferon-inducible protein 10, monokine induced by interferon gamma, and interferon-inducible T-cell alpha chemoattractant are produced by thymic epithelial cells and attract T-cell receptor (TCR) alphabeta+ CD8+ single-positive T cells, TCRgammadelta+ T cells, and natural killer-type cells in human thymus.
11110785 2001 The ligands of CXC chemokine receptor 3, I-TAC, Mig, and IP10, are natural antagonists for CCR3.
10903763 2000 CXCR3 expression and activation of eosinophils: role of IFN-gamma-inducible protein-10 and monokine induced by IFN-gamma.
10570316 1999 Chemokine and chemokine receptor interactions provide a mechanism for selective T cell recruitment to specific liver compartments within hepatitis C-infected liver.
10233762 1999 Human IP-9: A keratinocyte-derived high affinity CXC-chemokine ligand for the IP-10/Mig receptor (CXCR3).
10201901 1999 Chemokine receptor responses on T cells are achieved through regulation of both receptor expression and signaling.
10201891 1999 Cutting edge: species specificity of the CC chemokine 6Ckine signaling through the CXC chemokine receptor CXCR3: human 6Ckine is not a ligand for the human or mouse CXCR3 receptors.
9730616 1998 The human gene encoding SCYB9B, a putative novel CXC chemokine, maps to human chromosome 4q21 like the closely related genes for MIG (SCYB9) and INP10 (SCYB10).
9660793 1998 Binding and functional properties of recombinant and endogenous CXCR3 chemokine receptors.
8976378 1996 Localization of the gene for the human MIG cytokine on chromosome 4q21 adjacent to INP10 reveals a chemokine "mini-cluster".
8476424 1993 HuMig: a new human member of the chemokine family of cytokines.
7595201 1995 Human Mig chemokine: biochemical and functional characterization.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.
2115167 1990 A macrophage mRNA selectively induced by gamma-interferon encodes a member of the platelet factor 4 family of cytokines.