Property Summary

NCBI Gene PubMed Count 40
PubMed Score 81.91
PubTator Score 41.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
active Crohn's disease 3.572 1.5e-02
active ulcerative colitis 3.189 4.1e-02
Barrett's esophagus 1.700 3.5e-02
colon cancer 2.000 3.5e-02
cystic fibrosis 2.478 1.2e-02
ependymoma 2.200 1.5e-04
esophageal adenocarcinoma 2.000 2.5e-02
gastric carcinoma 2.700 3.1e-02
head and neck cancer 1.900 1.5e-04
interstitial cystitis 1.500 2.9e-02
intraductal papillary-mucinous adenoma (... 1.800 4.6e-03
intraductal papillary-mucinous neoplasm ... 1.900 1.8e-02
lung adenocarcinoma -1.465 4.4e-05
lung cancer -5.300 8.6e-08
malignant mesothelioma -3.900 1.1e-07
nasopharyngeal carcinoma 1.300 1.0e-02
non-small cell lung cancer -2.788 2.6e-16
ovarian cancer 1.200 1.7e-02
pancreatic cancer 2.100 1.6e-04
psoriasis 2.100 8.2e-45
spina bifida -1.544 2.7e-02
tuberculosis -5.100 6.7e-06

 IMPC Phenotype (1)

Protein-protein Interaction (5)

Gene RIF (21)

AA Sequence

MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCA      1 - 70
QTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN                                      71 - 107
//

Text Mined References (41)

PMID Year Title