Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.14
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Rheumatoid Arthritis 1.200 4.9e-02
atypical teratoid / rhabdoid tumor -1.100 4.3e-03
glioblastoma -1.400 3.9e-03
medulloblastoma -1.100 5.9e-03
medulloblastoma, large-cell -1.400 5.7e-04
tuberculosis 1.100 8.5e-04
intraductal papillary-mucinous adenoma (... 1.300 7.9e-03
adult high grade glioma -1.400 5.5e-03
ovarian cancer 2.400 2.6e-06

 MGI Phenotype (1)

Gene RIF (2)

PMID Text
25478830 The crystal structure of a relatively protease-resistant N-terminal fragment of human Cwc27 containing the cyclophilin-type peptidyl-prolyl cis-trans isomerase domain was determined at 2.0 A resolution.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSNIYIQEPPTNGKVLLKTTAGDIDIELWSKEAPKACRNFIQLCLEAYYDNTIFHRVVPGFIVQGGDPTG      1 - 70
TGSGGESIYGAPFKDEFHSRLRFNRRGLVAMANAGSHDNGSQFFFTLGRADELNNKHTIFGKVTGDTVYN     71 - 140
MLRLSEVDIDDDERPHNPHKIKSCEVLFNPFDDIIPREIKRLKKEKPEEEVKKLKPKGTKNFSLLSFGEE    141 - 210
AEEEEEEVNRVSQSMKGKSKSSHDLLKDDPHLSSVPVVESEKGDAPDLVDDGEDESAEHDEYIDGDEKNL    211 - 280
MRERIAKKLKKDTSANVKSAGEGEVEKKSVSRSEELRKEARQLKRELLAAKQKKVENAAKQAEKRSEEEE    281 - 350
APPDGAVAEYRREKQKYEALRKQQSKKGTSREDQTLALLNQFKSKLTQAIAETPENDIPETEVEDDEGWM    351 - 420
SHVLQFEDKSRKVKDASMQDSDTFEIYDPRNPVNKRRREESKKLMREKKERR                      421 - 472
//

Text Mined References (16)

PMID Year Title
25478830 2014 Structure and evolution of the spliceosomal peptidyl-prolyl cis-trans isomerase Cwc27.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19941820 2009 The evolutionarily conserved core design of the catalytic activation step of the yeast spliceosome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
9610721 1998 Characterization of human colon cancer antigens recognized by autologous antibodies.
9480850 1998 High resolution physical mapping and identification of transcribed sequences in the Down syndrome region-2.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.