Property Summary

Ligand Count 49
NCBI Gene PubMed Count 41
PubMed Score 227.67
PubTator Score 150.60

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

AA Sequence

MKTLLLLLLVLLELGEAQGSLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPL      1 - 70
INYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYG     71 - 140
TGSLSGIIGADQVSAFATQVEGLTVVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMM    141 - 210
AQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEG    211 - 280
CQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFV    281 - 350
DGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVP                       351 - 401
//

Text Mined References (43)

PMID Year Title