Property Summary

NCBI Gene PubMed Count 30
PubMed Score 99.53
PubTator Score 18.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.500 8.0e-03
atypical teratoid / rhabdoid tumor -3.600 4.4e-04
glioblastoma -1.500 1.9e-03
group 3 medulloblastoma -2.100 9.4e-03
lung cancer 3.000 4.0e-06
lung carcinoma 1.900 1.0e-35
medulloblastoma, large-cell -3.900 1.2e-04
posterior fossa group A ependymoma -1.200 1.5e-03
primitive neuroectodermal tumor -1.400 4.4e-02

Protein-protein Interaction (2)

Gene RIF (17)

AA Sequence

MTSATSPIILKWDPKSLEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVLAASVEQATQN      1 - 70
FLEKGEQIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKRGTMVRAARALLSAVTRLLIL     71 - 140
ADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFGKEMVKLNYVAARRQQELKDPHCRDEMAAAR    141 - 210
GALKKNATMLYTASQAFLRHPDVAATRANRDYVFKQVQEAIAGISNAAQATSPTDEAKGHTGIGELAAAL    211 - 280
NEFDNKIILDPMTFSEARFRPSLEERLESIISGAALMADSSCTRDDRRERIVAECNAVRQALQDLLSEYM    281 - 350
NNTGRKEKGDPLNIAIDKMTKKTRDLRRQLRKAVMDHISDSFLETNVPLLVLIEAAKSGNEKEVKEYAQV    351 - 420
FREHANKLVEVANLACSISNNEEGVKLVRMAATQIDSLCPQVINAALTLAARPQSKVAQDNMDVFKDQWE    421 - 490
KQVRVLTEAVDDITSVDDFLSVSENHILEDVNKCVIALQEGDVDTLDRTAGAIRGRAARVIHIINAEMEN    491 - 560
YEAGVYTEKVLEATKLLSETVMPRFAEQVEVAIEALSANVPQPFEENEFIDASRLVYDGVRDIRKAVLMI    561 - 630
RTPEELEDDSDFEQEDYDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEEKAKIAEQVEIFHQEKSKLDAE    631 - 700
VAKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSA    701 - 770
CKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELIVSGTGVQSTFTTFYEVDCDVIDGGRASQLSTHL    771 - 840
PTCAEGAPIGSGSSDSSMLDSATSLIQAAKNLMNAVVLTVKASYVASTKYQKVYGTAAVNSPVVSWKMKA    841 - 910
PEKKPLVKREKPEEFQTRVRRGSQKKHISPVQALSEFKAMDSF                               911 - 953
//

Text Mined References (33)

PMID Year Title