Property Summary

NCBI Gene PubMed Count 42
PubMed Score 234.60
PubTator Score 423.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.364 6.2e-05

Synonym

Accession Q16619 A8MVX4 Q5U5Y7 CT-1
Symbols CT1
CT-1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (4)

Gene RIF (31)

PMID Text
26621340 non-diabetic subjects who were overweight or obesity had significantly lower cardiotrophin-1 concentrations than those with normal weight, and both obesity and being overweight were inversely associated with cardiotrophin-1 levels.
26188636 This paper will review many aspects of CT-1 physiological role in several organs and discuss data for consideration in therapeutic approaches.
25919795 biliary epithelium-derived CT-1 may exert a profibrogenic potential in PCLD.
25689900 Data show that cardiotrophin-1 is positively related to brachial-ankle pulse-wave velocity (baPWV) independent of traditional cardiometabolic risk factors for arterial stiffness.
25025664 this study, even though preliminary and awaiting further confirmation by independent replication, provides first evidence that common genetic variation in CTF1 could contribute to insulin sensitivity in humans.
24401751 Study correlates CT-1 levels with ambulatory and central BP, as well as with pulse wave velocity in patients with essential hypertension.
24366078 exaggerated cardiomyocyte production of cardiotrophin-1 in response to increased left ventricular end-diastolic stress may contribute to fibrosis through stimulation of fibroblasts in heart failure of hypertensive origin.
24344663 CT-1 is differentially induced in the myocardium of infants with congenital cardiac defects depending on hypoxemia, and may mediate myocardial hypertrophy and dysfunction.
24054317 Subjects with impaired glucose tolerance (IGT) and newly diagnosed diabetes (NDD) have significantly higher CT-1 concentrations than those with normal glucose tolerance. IGT and NDD are positively associated with CT-1 concentrations.
23935888 CT-1 induces the proteolytic potential in human aortic endothelial cells by upregulating MMP-1 expression.
23856329 A reduction in serum CT-1 levels after a WL program.
22418690 Cardiotrophin-1 may serve as both a biomarker of left ventricular hypertrophy and dysfunction in hypertensive patients, and is potential target for therapies aimed to prevent and treat hypertensive heart disease beyond blood pressure control.
21771897 Hypoxia increased cardiotrophin-1 levels in cardiac cells through a direct regulation of CT-1 promoter by HIF-1alpha, protecting cells from apoptosis.
21572008 CT-1 treatment of myofibroblasts was associated with increased phosphorylation of myosin light chain kinase via myosin light chain kinase to induce cell migration.
20683337 the 1742(C/G) polymorphism of the human CT-1 gene is associated with LVH in hypertension, and the GG genotype may have a protective role
20683337 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20474083 Observational study of genetic testing. (HuGE Navigator)
20224758 Data show that both protein synthesis and intracellular transport are essential for cardiotrophin-1 induced TNFalpha expression.
20053569 This study aims to analyse cardiotrophin-1 (CT-1) and Tumor Necrosis Factor-alpha (TNF-alpha) plasma levels at rest and during exercise in elite athletes and healthy controls.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19273604 Results indicate that transcription factors such as CTF1 can act to delimit chromatin domain boundaries at mammalian telomeres, thereby blocking the propagation of a silent chromatin structure.
19155793 Plasma cardiotrophin-1 is associated with progression of heart failure in hypertensive patients.
18609050 Perioperative plasma brain natriuretic peptide and cardiotrophin-1 measured in off-pump coronary artery bypass.
17979974 Increased expression of some IL-6 cytokine family members (oncostatin M, gp130, CT-1, LIF) in cutaneous inflammation might contribute to the promotion of hair loss.
17940213 adipose tissue can be recognized as a source of CT-1, which could account for the high circulating levels of CT-1 in patients with metabolic syndrome X
17483238 CT-1 and TGF-beta 1 exert differential effects on myofibroblast proliferation and contraction in vitro. A balance of these effects may be important for normal cardiac wound healing.
15339920 Data show that cardiotrophin (CT-1) is a potent regulator of signaling in adipocytes in vitro and in vivo.
15219667 Our study clearly demonstrates production of CT-1 in the postnatal and adult CNS, specifically by cell types comprising the blood-CSF barrier, and its accumulation in ventricular ependyma.
12707269 Leukemia inhibitory factor (LIF), cardiotrophin-1, and oncostatin M share structural binding determinants in the immunoglobulin-like domain of LIF receptor
12234945 upregulation of cardiotrophin-1 in congestive heart failure

AA Sequence

MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAG      1 - 70
LSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALL     71 - 140
AALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA             141 - 201
//

Text Mined References (43)

PMID Year Title
26621340 2015 Cardiotrophin-1 is inversely associated with obesity in non-diabetic individuals.
26188636 2015 Cardiotrophin-1: A multifaceted cytokine.
25919795 2015 A Potential Profibrogenic Role of Biliary Epithelium-Derived Cardiotrophin-1 in Pediatric Cholestatic Liver Disease.
25689900 2015 Cardiotrophin-1 is associated with increased risk of arterial stiffness.
25416956 2014 A proteome-scale map of the human interactome network.
25025664 2014 Common genetic variation in the human CTF1 locus, encoding cardiotrophin-1, determines insulin sensitivity.
24401751 2014 Association between cardiotrophin 1 levels and central blood pressure in untreated patients with essential hypertension.
24366078 2014 Association of cardiotrophin-1 with myocardial fibrosis in hypertensive patients with heart failure.
24344663 2014 Myocardial cardiotrophin-1 is differentially induced in congenital cardiac defects depending on hypoxemia.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24054317 2013 Increased cardiotrophin-1 in subjects with impaired glucose tolerance and newly diagnosed diabetes.
23935888 2013 Cardiotrophin-1 induces matrix metalloproteinase-1 in human aortic endothelial cells.
23856329 2013 Decreased cardiotrophin-1 levels are associated with a lower risk of developing the metabolic syndrome in overweight/obese children after a weight loss program.
22418690 2012 Cardiotrophin-1 in hypertensive heart disease.
21912637 2011 CNTF mediates neurotrophic factor secretion and fluid absorption in human retinal pigment epithelium.
21771897 2011 HIF-1-mediated up-regulation of cardiotrophin-1 is involved in the survival response of cardiomyocytes to hypoxia.
21572008 2011 Role of myosin light chain kinase in cardiotrophin-1-induced cardiac myofibroblast cell migration.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20683337 2010 Protective effect of the 1742(C/G) polymorphism of human cardiotrophin-1 against left ventricular hypertrophy in essential hypertension.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20474083 2010 A novel custom resequencing array for dilated cardiomyopathy.
20224758 2009 Cardiotrophin-1 induces tumor necrosis factor alpha synthesis in human peripheral blood mononuclear cells.
20053569 2010 Cardiotrophin-1 and TNF-alpha circulating levels at rest and during cardiopulmonary exercise test in athletes and healthy individuals.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19273604 2009 Transcription factor CTF1 acts as a chromatin domain boundary that shields human telomeric genes from silencing.
19155793 2009 Association of plasma cardiotrophin-1 with stage C heart failure in hypertensive patients: potential diagnostic implications.
18609050 2008 Perioperative plasma brain natriuretic peptide and cardiotrophin-1 in off-pump coronary artery bypass.
17979974 2008 Interleukin-6 cytokine family member oncostatin M is a hair-follicle-expressed factor with hair growth inhibitory properties.
17940213 2008 Cardiotrophin-1 is expressed in adipose tissue and upregulated in the metabolic syndrome.
17483238 2007 Differential and combined effects of cardiotrophin-1 and TGF-beta1 on cardiac myofibroblast proliferation and contraction.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15339920 2004 Effects of cardiotrophin on adipocytes.
15219667 2004 Cardiotrophin-1 in choroid plexus and the cerebrospinal fluid circulatory system.
12707269 2003 Leukemia inhibitory factor (LIF), cardiotrophin-1, and oncostatin M share structural binding determinants in the immunoglobulin-like domain of LIF receptor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12234945 2002 Augmented expression of cardiotrophin-1 in failing human hearts is accompanied by diminished glycoprotein 130 receptor protein abundance.
11834704 2002 Cardiotrophin-1 stimulation of cardiac fibroblast growth: roles for glycoprotein 130/leukemia inhibitory factor receptor and the endothelin type A receptor.
11058912 2000 Genetic variants in the promoter (g983G>T) and coding region (A92T) of the human cardiotrophin-1 gene (CTF1) in patients with dilated cardiomyopathy.
8833032 1996 Human cardiotrophin-1: protein and gene structure, biological and binding activities, and chromosomal localization.
8755479 1996 Cardiotrophin-1, a cytokine present in embryonic muscle, supports long-term survival of spinal motoneurons.
7862649 1995 Expression cloning of cardiotrophin 1, a cytokine that induces cardiac myocyte hypertrophy.
7738033 1995 Cardiotrophin-1. Biological activities and binding to the leukemia inhibitory factor receptor/gp130 signaling complex.