Property Summary

NCBI Gene PubMed Count 44
PubMed Score 246.75
PubTator Score 423.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.364 6.2e-05

 GWAS Trait (1)

Gene RIF (33)

AA Sequence

MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAG      1 - 70
LSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALL     71 - 140
AALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA             141 - 201
//

Text Mined References (45)

PMID Year Title