Property Summary

NCBI Gene PubMed Count 12
PubMed Score 173.40
PubTator Score 67.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis 1.600 3.5e-02
posterior fossa group A ependymoma 1.400 1.1e-06
glioblastoma 1.500 1.7e-03
atypical teratoid / rhabdoid tumor 1.500 3.4e-05
group 3 medulloblastoma 1.400 4.0e-04
pancreatic ductal adenocarcinoma liver m... -1.025 4.0e-02
lung cancer -1.300 8.5e-03
pediatric high grade glioma 1.400 3.2e-04
pilocytic astrocytoma 1.600 5.8e-06
subependymal giant cell astrocytoma 1.063 1.7e-02
ovarian cancer 1.900 8.1e-06

Synonym

Accession Q01459 Q5VX50
Symbols CTB

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
26768631 Data indicate that infliximab changes the concentration of hexosaminidase (N-acetyl-beta-glucosaminidase; HEX) activity depending on the drug dose and time of administration.
16794344 biochemical behavior of di-N-acetylchitobiase indicates it has three subsites, -2, -1, +1, in which the reducing-end trimer of any sized chitooligosaccharide is bound. The +1 site is specific for an alpha-anomer.

AA Sequence

MSRPQLRRWRLVSSPPSGVPGLALLALLALLALRLAAGTDCPCPEPELCRPIRHHPDFEVFVFDVGQKTW      1 - 70
KSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGDVSLKDIIDPAFRASWIAQKLNLAKTQYMDGINI     71 - 140
DIEQEVNCLSPEYDALTALVKETTDSFHREIEGSQVTFDVAWSPKNIDRRCYNYTGIADACDFLFVMSYD    141 - 210
EQSQIWSECIAAANAPYNQTLTGYNDYIKMSINPKKLVMGVPWYGYDYTCLNLSEDHVCTIAKVPFRGAP    211 - 280
CSDAAGRQVPYKTIMKQINSSISGNLWDKDQRAPYYNYKDPAGHFHQVWYDNPQSISLKATYIQNYRLRG    281 - 350
IGMWNANCLDYSGDAVAKQQTEEMWEVLKPKLLQR                                       351 - 385
//

Text Mined References (15)

PMID Year Title
26768631 Fibroblast-Like Synovial Cells in Rheumatoid Arthritis--the Impact of Infliximab on Hexosaminidase Activity.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
16794344 2006 Optimum substrate size and specific anomer requirements for the reducing-end glycoside hydrolase di-N-acetylchitobiase.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11907625 2002 N-acetyl beta-D-glucosaminidase is not attached to human sperm membranes through the glycosylphosphatidyl inositol (GPI)-anchor.
10336991 1999 Structure of the human gene for lysosomal di-N-acetylchitobiase.
7606925 1995 Lysosomal chitobiase (CTB) and the G-protein gamma 5 subunit (GNG5) genes co-localize to human chromosome 1p22.
2751306 1989 Rat liver chitobiase: purification, properties, and role in the lysosomal degradation of Asn-linked glycoproteins.
2531691 1989 Lysosomal degradation of Asn-linked glycoproteins.
1549114 1992 Characterization of the cDNA and genomic sequence of a G protein gamma subunit (gamma 5).
1527079 1992 Cloning and expression of the cDNA sequence encoding the lysosomal glycosidase di-N-acetylchitobiase.