Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.0e-36

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.300 2.0e-36

AA Sequence

MMHTTSYRRLSPPHLTDQPSAYSHTHRTFSHFSCGSQPAAQRLHVELWNADLQSEFLCPCLGLTLYLTCN      1 - 70
PQLGKRKFCSHSSEDMSKMVSRRNVKDSHEVSGSLQATLQVISFSFPFLLHTCSHPLSHPTSGQRR         71 - 136
//

Text Mined References (4)

PMID Year Title