Property Summary

NCBI Gene PubMed Count 62
PubMed Score 188.27
PubTator Score 101.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
glioblastoma 2.900 5.3e-04
malignant mesothelioma 1.400 1.1e-05
esophageal adenocarcinoma -3.800 4.0e-02
uncontrolled asthma 1.200 3.4e-02
osteosarcoma -4.585 1.8e-05
chronic lymphosyte leukemia -2.500 2.0e-08
posterior fossa group A ependymoma 1.500 7.8e-05
atypical teratoid / rhabdoid tumor 1.100 2.8e-02
primary pancreatic ductal adenocarcinoma 1.231 8.6e-03
intraductal papillary-mucinous adenoma (... 2.200 2.4e-03
intraductal papillary-mucinous neoplasm ... 2.800 7.0e-03
lung cancer -4.100 6.8e-03
pancreatic cancer 1.400 2.8e-03
adult high grade glioma 1.600 1.5e-02
pilocytic astrocytoma 2.000 2.0e-06
primary Sjogren syndrome 1.900 1.4e-03
subependymal giant cell astrocytoma 2.480 3.6e-02
lung adenocarcinoma -2.213 5.3e-05
psoriasis 2.100 1.5e-130
lung carcinoma -1.500 2.6e-16
spina bifida -2.204 3.7e-02
Breast cancer -1.400 3.6e-02
ulcerative colitis 2.800 4.7e-06
ovarian cancer -2.800 2.5e-04
cystic fibrosis and chronic rhinosinusit... 1.839 3.2e-02
dermatomyositis 1.600 3.0e-03

Gene RIF (27)

PMID Text
26634210 Both MIP-3alpha and cystatin A overexpressions in NPC tumor tissues were strong independent factors of poor prognosis in NPC patients.
25785582 a novel pathway of CSTA regulation involving Dsg2
23656633 High levels of bioactive recombinant stefins A and B can be produced by fermentation in P. pastoris.
23546957 Data indicate that desmoplakin (DSP) and cystatin A (CSTA) interaction and insulin-like growth factor 1 (IGF-1), IGF-binding protein 7 (IGFBP7) and syndecan 1 (SDC1) interaction were observed in protein-protein interaction (PPI) network.
23534700 We identified a homozygous nonsense mutation (p.Lys22X) in the CSTA gene in acral peeling skin syndrome.
22787201 Imiquimod suppresses propagation of herpes simplex virus 1 by upregulation of cystatin A via the adenosine receptor A1 pathway
22615763 findings provide a new molecular understanding of the mechanisms of MYOC-causative glaucoma and reveal CSTA, a serum biomarker for cancer, as a potential biomarker and drug for the treatment of MYOC-induced glaucoma
21944047 study identified loss-of-function mutations in the gene for protease inhibitor cystatin A as the underlying genetic cause of exfoliative ichthyosis
21412248 CSTA significantly increases the risk of developing psoriasis in HLA-Cw6 individuals
21325429 Findings establish that genetic variability, smoking, and COPD all influence CSTA expression, as does SCC, supporting the concept that CSTA may make pivotal contributions to NSCLC pathogenesis in early and late stages of disease development.
21038029 Up-regulation of stefin A, an endogenous inhibitor of cathepsin S, was found in inverted papilloma tissues as compared with its expression level in normal sinus mucosa tissues.
20461718 A higher pretreated serum level of cystatin A was found to be associated with a higher nodal stage and poorer prognosis of nasopharyngeal carcinoma patients.
19933866 Cystatin A binds reduced forms of mite group 1 allergens Der f 1 and Der p 1, in which the cysteine residue at the catalytic center of the protease activity is reduced by treatment with L-cysteine but does not bind oxidized forms.
18364739 CSTA TCC haplotype is only associated with psoriasis in those individuals carrying the risk allele at the HLA-Cw6 locus
18364739 Observational study of gene-disease association. (HuGE Navigator)
17985332 We conclude that Stefin A expression reduces distant metastasis in breast cancer and propose that this may be due to the inhibition of cysteine cathepsins, such as cathepsin B.
17441792 +344C allele associated with unstable mRNA could result in failing to protect the skin barrier in atopic dermatitis patients from both exogenous and endogenous proteases.
17412564 Cystatin A suppresses UVB-induced apoptosis of keratinocytes by the inhibition of caspase 3 activation.
16969475 only stefins A and B, i.e. type I cystatins, are up-regulated in lung tumours and thus able to counteract harmful tumour-associated proteolytic activity
16342276 Chimeras of stefinA and B have been prepared and guanidine denaturation curves and folding rates have been examined.
15175029 Observational study of gene-disease association. (HuGE Navigator)
15175029 No association with psoriasis susceptibility
15048832 By using ThT fluorescence, X-ray diffraction, and atomic force microscopy (AFM), it has been shown that human stefins A and B (subfamily A of cystatins) form amyloid fibrils
14747998 backbone dynamics of the monomeric and domain-swapped dimeric forms of stefin A by (15)N relaxation using a model-free approach
12682854 The 1,25(OH)(2)D3-responsive element in cystatin A gene is identical to TRE, T2 (-272 to -278). Suppression of Raf-1/MEK1/ERK1,2 signaling pathway increases cystatin A expression of normal human keratinocytes.
12581647 crystal structure in complex with cathepsin H
11451947 expression of cystatin A is regulated via mitogen-activated protein kinase pathways positively by Ras/MEKK1/MKK7/JNK and negatively by Ras/Raf/MEK1/ERK.

AA Sequence

MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVF      1 - 70
KSLPGQNEDLVLTGYQVDKNKDDELTGF                                               71 - 98
//

Text Mined References (66)

PMID Year Title
26634210 2015 Expression and Prognostic Significance of Macrophage Inflammatory Protein-3 Alpha and Cystatin A in Nasopharyngeal Carcinoma.
25785582 2015 Cell cycle- and cancer-associated gene networks activated by Dsg2: evidence of cystatin A deregulation and a potential role in cell-cell adhesion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23656633 Functional expression of amyloidogenic human stefins A and B in Pichia pastoris using codon optimization.
23546957 2013 Protein interaction and microRNA network analysis in osteoarthritis meniscal cells.
23534700 Acral peeling skin syndrome resulting from a homozygous nonsense mutation in the CSTA gene encoding cystatin A.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22787201 2012 Imiquimod suppresses propagation of herpes simplex virus 1 by upregulation of cystatin A via the adenosine receptor A1 pathway.
22615763 2012 Cystatin a, a potential common link for mutant myocilin causative glaucoma.
21944047 2011 Mutations in CSTA, encoding Cystatin A, underlie exfoliative ichthyosis and reveal a role for this protease inhibitor in cell-cell adhesion.
21412248 2011 HLA-C, CSTA and DS12346 susceptibility alleles confer over 100-fold increased risk of developing psoriasis: evidence of gene interaction.
21325429 2011 Modulation of cystatin A expression in human airway epithelium related to genotype, smoking, COPD, and lung cancer.
21269460 2011 Initial characterization of the human central proteome.
21038029 2010 Expression of cathepsin S and its inhibitor stefin A in sinonasal inverted papilloma.
20705733 2010 Common variants in the calcium-sensing receptor gene are associated with total serum calcium levels.
20558539 2010 Common genetic variants associate with serum phosphorus concentration.
20461718 2010 Identification of candidate nasopharyngeal carcinoma serum biomarkers by cancer cell secretome and tissue transcriptome analysis: potential usage of cystatin A for predicting nodal stage and poor prognosis.
19933866 2009 Modulation of allergenicity of major house dust mite allergens Der f 1 and Der p 1 by interaction with an endogenous ligand.
18364739 2008 Association analysis of the skin barrier gene cystatin A at the PSORS5 locus in psoriatic patients: evidence for interaction between PSORS1 and PSORS5.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17985332 2008 Primary tumour expression of the cysteine cathepsin inhibitor Stefin A inhibits distant metastasis in breast cancer.
17441792 2007 A nonsynonymous substitution of cystatin A, a cysteine protease inhibitor of house dust mite protease, leads to decreased mRNA stability and shows a significant association with atopic dermatitis.
17412564 2007 Cystatin A suppresses ultraviolet B-induced apoptosis of keratinocytes.
16969475 2006 Cystatins in non-small cell lung cancer: tissue levels, localization and relation to prognosis.
16342276 2006 Folding and amyloid-fibril formation for a series of human stefins' chimeras: any correlation?
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15175029 2004 Association analysis of cystatin A and zinc finger protein 148, two genes located at the psoriasis susceptibility locus PSORS5.
15048832 2004 Different propensity to form amyloid fibrils by two homologous proteins-Human stefins A and B: searching for an explanation.
14747998 2004 Comparison of backbone dynamics of monomeric and domain-swapped stefin A.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14503883 2003 Grafting of features of cystatins C or B into the N-terminal region or second binding loop of cystatin A (stefin A) substantially enhances inhibition of cysteine proteinases.
12921779 2003 Protein inhibitors form complexes with procathepsin L and augment cleavage of the propeptide.
12890214 2003 An autosomal recessive exfoliative ichthyosis with linkage to chromosome 12q13.
12682854 2003 1,25-dihydroxyvitamin D(3) increases human cystatin A expression by inhibiting the Raf-1/MEK1/ERK signaling pathway of keratinocytes.
12581647 2003 Crystal structure of Stefin A in complex with cathepsin H: N-terminal residues of inhibitors can adapt to the active sites of endo- and exopeptidases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11532941 2001 Three-dimensional domain swapping in the folded and molten-globule states of cystatins, an amyloid-forming structural superfamily.
11451947 2001 Expression of human cystatin A by keratinocytes is positively regulated via the Ras/MEKK1/MKK7/JNK signal transduction pathway but negatively regulated via the Ras/Raf-1/MEK1/ERK pathway.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
10908733 2000 Small proline-rich protein 1 is the major component of the cell envelope of normal human oral keratinocytes.
10353845 1999 The contribution of N-terminal region residues of cystatin A (stefin A) to the affinity and kinetics of inhibition of papain, cathepsin B, and cathepsin L.
9769367 Cysteine proteinases and their endogenous inhibitors: target proteins for prognosis, diagnosis and therapy in cancer (review).
9651321 1998 Structure and transcriptional regulation of the human cystatin A gene. The 12-O-tetradecanoylphorbol-13-acetate (TPA) responsive element-2 site (-272 to -278) on cystatin A gene is critical for TPA-dependent regulation.
9585570 1998 The role of Gly-4 of human cystatin A (stefin A) in the binding of target proteinases. Characterization by kinetic and equilibrium methods of the interactions of cystatin A Gly-4 mutants with papain, cathepsin B, and cathepsin L.
9522124 1997 Genomic structure of human cystatin A.
9219725 1997 Cathepsin B and cysteine proteinase inhibitors in human lung cancer cell lines.
9007972 1997 Friends and relations of the cystatin superfamily--new members and their evolution.
8999895 1997 Direct evidence that involucrin is a major early isopeptide cross-linked component of the keratinocyte cornified cell envelope.
7869384 1995 The three-dimensional solution structure of human stefin A.
7578072 1995 Solution structure of a human cystatin A variant, cystatin A2-98 M65L, by NMR spectroscopy. A possible role of the interactions between the N- and C-termini to maintain the inhibitory active form of cystatin A.
7541394 1995 Expression of acid cysteine proteinase inhibitor (ACPI) in the normal human prostate, benign prostatic hyperplasia and adenocarcinoma.
6689312 1983 Protein inhibitors of cysteine proteinases. II. Primary structure of stefin, a cytosolic protein inhibitor of cysteine proteinases from human polymorphonuclear granulocytes.
6429090 1984 Immunolocalization of human cystatins in neutrophils and lymphocytes.
6203523 1984 The place of human gamma-trace (cystatin C) amongst the cysteine proteinase inhibitors.
3488317 1986 Isolation of six cysteine proteinase inhibitors from human urine. Their physicochemical and enzyme kinetic properties and concentrations in biological fluids.
3122506 1987 Human cystatins in normal and diseased tissues--a review.
3067731 1988 Chemical synthesis of a gene for human stefin A and its expression in E. coli.
2768224 1989 Comparative studies on the primary structure of human cystatin as from epidermis, liver, spleen, and leukocytes.
2442723 1987 Effects of UV, 4-NQO and TPA on gene expression in cultured human epidermal keratinocytes.
2424340 1986 [Low-molecular cysteine protease inhibitors in the human palatal tonsil].
2004763 1991 Mapping of the gene for human cysteine proteinase inhibitor stefin A, STF1, to chromosome 3cen-q21.
1940442 1991 Molecular cloning, occurrence, and expression of a novel partially secreted protein "psoriasin" that is highly up-regulated in psoriatic skin.
1286667 1992 Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.
107703 1978 Localization of the human SH-protease inhibitor in the epidermis. Immunofluorescent studies.
107702 1978 A protein reminiscent of the epidermal SH-protease inhibitor occurs in squamous epithelia of man and rat.