Property Summary

NCBI Gene PubMed Count 67
PubMed Score 201.68
PubTator Score 101.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Cancer 2499 3.505 1.8
Skin disease 66 3.184 1.6

Expression

  Differential Expression (26)

Disease log2 FC p
glioblastoma 1.400 5.4e-03
adult high grade glioma 1.600 1.5e-02
Astrocytoma, Pilocytic 2.000 1.7e-06
atypical teratoid / rhabdoid tumor 1.100 2.8e-02
Breast cancer -1.400 3.6e-02
chronic lymphosyte leukemia -2.500 2.0e-08
cystic fibrosis and chronic rhinosinusit... 1.839 3.2e-02
dermatomyositis 1.600 3.0e-03
ependymoma 1.100 2.8e-03
esophageal adenocarcinoma -3.800 4.0e-02
intraductal papillary-mucinous adenoma (... 2.200 2.4e-03
intraductal papillary-mucinous neoplasm ... 2.800 7.0e-03
lung adenocarcinoma -1.500 1.0e-06
lung cancer -2.900 7.3e-04
lung carcinoma -1.500 2.6e-16
malignant mesothelioma 1.400 1.1e-05
osteosarcoma -4.585 1.8e-05
ovarian cancer -2.800 2.5e-04
pancreatic cancer 1.400 2.8e-03
primary pancreatic ductal adenocarcinoma 1.231 8.6e-03
primary Sjogren syndrome 1.900 1.4e-03
psoriasis 1.200 2.5e-14
spina bifida -2.204 3.7e-02
subependymal giant cell astrocytoma 2.480 3.6e-02
ulcerative colitis 2.800 4.7e-06
uncontrolled asthma 1.200 3.4e-02

PDB (12)

Gene RIF (32)

AA Sequence

MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVF      1 - 70
KSLPGQNEDLVLTGYQVDKNKDDELTGF                                               71 - 98
//

Text Mined References (71)

PMID Year Title