Property Summary

NCBI Gene PubMed Count 11
PubMed Score 360.77
PubTator Score 9.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.700 4.2e-05
malignant mesothelioma 1.600 3.6e-07
medulloblastoma, large-cell -1.800 1.6e-03
oligodendroglioma 1.400 2.2e-02
ovarian cancer 2.000 6.4e-08
Pick disease -1.600 8.8e-05
pituitary cancer 1.300 1.5e-03
posterior fossa group A ependymoma -1.100 7.1e-04
sonic hedgehog group medulloblastoma -2.300 3.5e-05
spina bifida 1.390 4.5e-02
subependymal giant cell astrocytoma -1.538 2.8e-02

 GO Function (1)

Gene RIF (4)

AA Sequence

MGRAGGGGPGRGPPPLLLFLGAALVLASGAVPAREAGSAVEAEELVKGSPAWEPPANDTREEAGPPAAGE      1 - 70
DEASWTAPGGELAGPEEVLQESAAVTGTAWLEADSPGLGGVTAEAGSGDAQALPATLQAPHEVLGQSIMP     71 - 140
PAIPEATEASGPPSPTPGDKLSPASELPKESPLEVWLNLGGSTPDPQGPELTYPFQGTLEPQPASDIIDI    141 - 210
DYFEGLDGEGRGADLGSFPGSPGTSENHPDTEGETPSWSLLDLYDDFTPFDESDFYPTTSFYDDLDEEEE    211 - 280
EEEDDKDAVGGGDLEDENELLVPTGKPGLGPGTGQPTSRWHAVPPQHTLGSVPGSSIALRPRPGEPGRDL    281 - 350
ASSENGTECRSGFVRHNGSCRSVCDLFPSYCHNGGQCYLVENIGAFCRCNTQDYIWHKGMRCESIITDFQ    351 - 420
VMCVAVGSAALVLLLLFMMTVFFAKKLYLLKTENTKLRRTNKFRTPSELHNDNFSLSTIAEGSHPNVRKL    421 - 490
CNTPRTSSPHARALAHYDNVICQDDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGGKGDQADLDVNC    491 - 560
LQNNLT                                                                    561 - 566
//

Text Mined References (13)

PMID Year Title