Property Summary

NCBI Gene PubMed Count 105
PubMed Score 172.75
PubTator Score 253.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -3.527 3.6e-04
tuberculosis 1.100 5.0e-05
non-small cell lung cancer -1.986 1.7e-15
lung cancer -1.500 1.4e-03
interstitial cystitis 1.200 4.7e-03
lung adenocarcinoma -1.072 4.2e-04
lung carcinoma -2.700 3.5e-30
ulcerative colitis 1.800 1.3e-03
psoriasis 1.100 4.4e-19

Gene RIF (70)

PMID Text
26956865 CSF3R mutations, mechanisms of mutations, and their contributions to the myeloid malignancies (Review)
26475333 The Colony-Stimulating Factor 3 Receptor T640N Mutation Is Oncogenic, Sensitive to JAK Inhibition, and Mimics T618I
26324699 CSF3R mutations are associated with congenital neutropenia.
25865944 A de novo CSF3R mutation was associated with the transformation of myeloproliferative neoplasm to atypical chronic myeloproliferative leukemia.
25858548 No CSF3R mutations were found in cases of MDS, JMML or ET. The only mutation found in the CALR gene was a frameshift (p.L367 fs) in one ET patient.
25850813 The SETBP1 and ASXL1 mutations have pathogenetic roles in CSF3R-mutated chronic neutrophilic leukemia.
25730818 The leukemogenic potential of G-CSFRIV is associated with the Stat5-dependent dysregulation of miR-155 and the target genes of this miRNA.
25708716 CSF3R polymorphisms are associated with chronic neutrophilic leukemia.
25666388 In conclusion, rhCSF3 can promote melanocyte proliferation through CSF3R without affecting tyrosinase activity
25533830 the incorporation of CSF3R mutation testing can be a useful point-of-care diagnostic to evaluate the presence of a clonal myeloid disorder, as well as providing the potential for genetically informed therapy.
25404019 study to see if the CSF3R p.T618I mutation was present in acute myelogenous leukemia (AML) and solid tumors of Korean patients; data revealed that CSF3R p.T618I mutation occurred in an AML with myelodysplasia-related changes and a refractory anemia with excess blasts in transformation
25316523 mutation analysis of CSF3R, SETBP1 and CALR should be included in the diagnostic criteria for chronic neutrophilic leukemia
24753537 this study describes a novel genetic Severe congenital neutropenia type in 2 unrelated families associated with recessively inherited loss-of-function mutations in CSF3R, encoding the granulocyte colony-stimulating factor (G-CSF) receptor.
24746896 frequency of CSF3R mutations is highly prevalent among acute myeloid leukemia patients secondary to severe congenital neutropenia compared to de novo AML.
24614839 CSF3R T618I mutation as a disease-specific marker of atypical CML post allo-SCT in two patients.
24574781 The expression of G-CSFR before preoperative irradiation may predict the radiosensitivity of rectal cancer.
24523240 The detection of both RUNX1 and CSF3R mutations could be used as a marker for identifying Congenital neutropenia patients with a high risk of progressing to leukemia or myelodysplastic syndromes.
24445868 concurrent CSF3R and SETBP1 mutations are associated with Chronic neutrophilic leukemia.
24403076 Thr-615 and Thr-618 sites of membrane-proximal mutations are part of an O-linked glycosylation cluster. Mutation at these sites prevents O-glycosylation of CSF3R and increases receptor dimerization.
24081659 Mice transplanted with human CSF3R T618I-expressing hematopoietic cells developed a myeloproliferative disorder characterized by overproduction of granulocytes and granulocytic infiltration of the spleen and liver, which was uniformly fatal.
23897249 In myelodysplastic syndromes, altered CD114 distribution was more informative than density changes. In CML, CD114 density was significantly decreased on early blasts and expression was essentially limited to late blasts.
23820376 Fbw7 together with GSK3beta negatively regulates G-CSFR expression and its downstream signaling.
23774674 findings show CSF3R somatic mutations can be identified in 4 percent of the patients with chronic myelomonocytic leukemia (CMML); these mutations, which affect distinct residues in CSF3R are frequently associated with mutations in ASXL1 gene and have a poor prognostic impact on overall and AML-free survival
23687340 A subpopulation of GCSFR positive neuroblastoma cells exhibit enhanced tumorigenicity and a stem cell phenotype.
23656643 Mutations in CSF3R are common in patients with CNL or atypical CML and represent a potentially useful criterion for diagnosing these neoplasms.
23508011 The stimulating factor 3 receptor mutation (CSF3R-T595I) found in acute myeloid leukemia patients was found to have ligand independent activation properties.
23159284 Certain missense single nucleotide polymorphisms, especially which are placed in the conserved regions of G-CSFR may possess the capacity to influence the response to G-CSF treatment.
22796466 CSF3R gene polymorphism plays a significant role in hematopoietic stem and progenitor cells for transplantation.
22146088 An acquired CSF3R mutation in an adult chronic idiopathic neutropenia patient who developed acute myeloid leukaemia.
21641233 Pretreatment of PMNs with IFN-gamma or G-CSF for a long-time (22 h)induced a significant lower fungal damage against biofilms compared with planktonic cells.
21129254 Gemcitabine can enhance in vitro the expression rate of bone marrow G-CSFR in chronic myeloid leukemia patients at chronic or blastic phases.
20819538 CD123+CD34+CD38- cells exhibited lower expression of G-CSF receptors, which might partly explain why MDS clone responds worse to G-CSF in vitro and in vivo.
20696205 Data from rna interference of G-CSFR messenger RNA demonstrated the limited specificity of antibodies for HuG-CSFR expressed on the cell surface.
20654748 The results reported in this study suggest a role for CSF3R in the determination of bone density in women.
20654748 Observational study of gene-disease association. (HuGE Navigator)
20557950 Transgenic Fn14/TWEAK receptor pathway in a mouse model is adversely involved in inflammatory and ischemic brain disease associated with the strongest increase of the endogenous neuroprotective G-CSF and the G-CSF receptor system.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20471446 G-CSF-induced upregulation of MT1-MMP in hematopoietic cells and its enhanced incorporation into membrane lipid rafts contributes to proMMP-2 activation, which facilitates mobilization of HSPC.
20237318 a possible role of G-CSF in malignant transformation, particularly in patients with neutropenia harboring mutations in the gene encoding the G-CSF receptor.
19833857 RAS and CSF3R mutations in severe congenital neutropenia.
19794089 Two cases of X-linked neutropenia are reported that evolved to acute myeloid leukemia or myelodysplasia, with acquisition of G-CSF receptor mutations.
19620628 identify an autosomal mutation in the CSF3R gene in a family with a chronic neutrophilia. This T617N mutation energetically favors dimerization of the granulocyte colony-stimulating factor (G-CSF) receptor transmembrane domain.
19453968 Data show that a lysine within the membrane-proximal region of the granulocyte colony-stimulating factor receptor is indispensable for ubiquitination and lysosomal sorting of the receptor.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19099633 There was no significant difference in expression rate of G-CSFR on CD34+ cells between aplastic anemia, myelodysplastic syndrome, and controls.
18923646 results indicate ubiquitination required for regulation of G-CSFR-mediated proliferation & cell survival; mutation disrupting G-CSFR ubiquitination induce aberrant signaling & proliferative response to G-CSF; this may contribute to leukemic transformation
18536571 REVIEW: Congenital neutropenia patients with acquired CSF3R mutations define a group with high risk for development of leukemia; discussion of possible pathomechanism
17703412 Observational study of gene-disease association. (HuGE Navigator)
17572226 The G-CSF/G-CSFR autocrine/paracrine signaling loop significantly promotes survival and growth of bladder cancer cells.
17494858 that mutations of CSF3R may provide the "activated tyrosine kinase signal" that is thought to be important for leukemogenesis.
17047971 The observed up-regulation of G-CSF receptors towards a role in the pathophysiology of human ischemic stroke.
17024119 single-nucleotide polymorphism (Glu785Lys) is associated with myelodysplastic syndromes and acute myeloid leukemia with multlineage dysplasia
16985178 Observational study of gene-disease association. (HuGE Navigator)
16985178 CSF3R nonsense mutations (10 new) in SCN at 17 sites lead to a loss Tyr residues in the intracellular domain of the receptor. CSF3R mutation is an early event in leukemogenesis that has to be accompanied by as yet undefined cooperating molecular events
16493051 Deleterious G-CSFR-mediated signaling events, such as aberrant Stat3 activation demonstrated in a subset of acute myeloid leukemia (AML) patients with poor prognosis, could be exploited for the treatment of AML patients.
16492764 crystal structure of the signaling complex between human granulocyte colony-stimulating factor (GCSF) and a ligand binding region of GCSF receptor (GCSF-R), has been determined to 2.8 A resolution
16033816 The Tyr 729 of the G-CSF-R is required for SOCS3-mediated negative regulation of G-CSF-R signaling and that the duration and intensity of G-CSF-induced Stat5 activation are regulated by two distinct mechanisms.
15644419 Observational study of gene-disease association. (HuGE Navigator)
15644419 lifelong altered G-CSF response by the G-CSF-R_785Lys may render individuals susceptible to development of high-risk M
15370243 reviewed the knowledge of the expression of G-CSFR and its role in the disorders of granulopoiesis, including myelodysplastic syndrome, and neutropenia in myelodysplastic patients
14992583 Thermodynamic data for the interaction of GCSF-GCSFR induced by GCSF binding suggest that the activated structure of GCSFR is a 2:2 complex structure.
14751388 G-CSFR expression in some bladder cancers appears to be an early event during malignant transformation that increases beta1-integrin expression and adhesion and thereby may promote tissue invasion.
14737106 selective inhibition of G-CSF receptor expression by C/EBPalphap30-ER is due in part to its variable affinity for C/EBP sites
12586631 the carboxy-terminal region of hGCSFR plays a role in the phagocytosis and Syk and Hck kinase tyrosine phosphorylation is involved.
12422946 abnormalities of primitive myeloid progenitor cells expressing G-CSFR may play an important role in the impairment of granulopoiesis in patients with severe congenital neutropenia
12012328 Novel variant involved in induction of cell proliferation; myelodysplastic syndrome; a deletion of three nucleotides (2128-2130) in the juxtamembrane domain of the G-CSFR resulted in a conversion of Asn(630)Arg(631) to Lys(630).
11920194 Lack of STAT3beta function in a differentiation-competent murine cell line expressing human G-CSFR argues against its having a role in Kip1 expression or neutrophil differentiation.
11714811 The C-terminus of the G-CSF receptor, truncated in patients with severe congenital neutropenia/acute myeloid leukemia, is required for SH2-containing phosphatase-1 suppression of G-CSF-stimulated Stat activation.
11468284 the dimerization interface of the complete receptor complex is different from that in the x-ray structure of a partial complex. A model of the tetrameric G-CSF.G-CSF-R complex was prepared

AA Sequence

MARLGNCSLTWAALIILLLPGSLEECGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQILWRLGAELQ      1 - 70
PGGRQQRLSDGTQESIITLPHLNHTQAFLSCCLNWGNSLQILDQVELRAGYPPAIPHNLSCLMNLTTSSL     71 - 140
ICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSILDCVPKDGQSHCCIPRKHLLLYQNMGIWVQAENALG    141 - 210
TSMSPQLCLDPMDVVKLEPPMLRTMDPSPEAAPPQAGCLQLCWEPWQPGLHINQKCELRHKPQRGEASWA    211 - 280
LVGPLPLEALQYELCGLLPATAYTLQIRCIRWPLPGHWSDWSPSLELRTTERAPTVRLDTWWRQRQLDPR    281 - 350
TVQLFWKPVPLEEDSGRIQGYVVSWRPSGQAGAILPLCNTTELSCTFHLPSEAQEVALVAYNSAGTSRPT    351 - 420
PVVFSESRGPALTRLHAMARDPHSLWVGWEPPNPWPQGYVIEWGLGPPSASNSNKTWRMEQNGRATGFLL    421 - 490
KENIRPFQLYEIIVTPLYQDTMGPSQHVYAYSQEMAPSHAPELHLKHIGKTWAQLEWVPEPPELGKSPLT    491 - 560
HYTIFWTNAQNQSFSAILNASSRGFVLHGLEPASLYHIHLMAASQAGATNSTVLTLMTLTPEGSELHIIL    561 - 630
GLFGLLLLLTCLCGTAWLCCSPNRKNPLWPSVPDPAHSSLGSWVPTIMEEDAFQLPGLGTPPITKLTVLE    631 - 700
EDEKKPVPWESHNSSETCGLPTLVQTYVLQGDPRAVSTQPQSQSGTSDQVLYGQLLGSPTSPGPGHYLRC    701 - 770
DSTQPLLAGLTPSPKSYENLWFQASPLGTLVTPAPSQEDDCVFGPLLNFPLLQGIRVHGMEALGSF        771 - 836
//

Text Mined References (108)

PMID Year Title
26956865 2016 Colony Stimulating Factor 3 Mutations and Myeloid Malignancies.
26475333 2016 The Colony-Stimulating Factor 3 Receptor T640N Mutation Is Oncogenic, Sensitive to JAK Inhibition, and Mimics T618I.
26324699 2015 GM-CSF stimulates granulopoiesis in a congenital neutropenia patient with loss-of-function biallelic heterozygous CSF3R mutations.
25865944 2015 De novo CSF3R mutation associated with transformation of myeloproliferative neoplasm to atypical CML.
25858548 2015 CSF3R and CALR mutations in paediatric myeloid disorders and the association of CSF3R mutations with translocations, including t(8; 21).
25850813 2015 ASXL1 mutations are frequent and prognostically detrimental in CSF3R-mutated chronic neutrophilic leukemia.
25730818 2015 miR-155 is associated with the leukemogenic potential of the class IV granulocyte colony-stimulating factor receptor in CD34? progenitor cells.
25708716 2015 Colony-stimulating factor-3 receptor, watch out for polymorphisms.
25666388 2015 rhCSF3 accelerates the proliferation of human melanocytes in culture through binding CSF3R and the expression of CSF3R transcripts.
25533830 2014 Current strategies in the diagnosis and management of chronic neutrophilic leukemia.
25404019 2015 Mutational analysis of oncogenic CSF3R p.T618I in acute leukemias and common solid cancers.
25316523 2014 CSF3R, SETBP1 and CALR mutations in chronic neutrophilic leukemia.
24753537 2014 Inherited biallelic CSF3R mutations in severe congenital neutropenia.
24746896 2014 Prevalence and impact of colony stimulating factor 3 receptor (CSF3R) mutations among Egyptian acute myeloid leukemia patients.
24614839 2014 The CSF3R T618I mutation as a disease-specific marker of atypical CML post allo-SCT.
24574781 2014 Expression of granulocyte colony-stimulating factor receptor in rectal cancer.
24523240 2014 Cooperativity of RUNX1 and CSF3R mutations in severe congenital neutropenia: a unique pathway in myeloid leukemogenesis.
24445868 2014 Chronic neutrophilic leukemia with concurrent CSF3R and SETBP1 mutations: single colony clonality studies, in vitro sensitivity to JAK inhibitors and lack of treatment response to ruxolitinib.
24403076 2014 Ligand independence of the T618I mutation in the colony-stimulating factor 3 receptor (CSF3R) protein results from loss of O-linked glycosylation and increased receptor dimerization.
24081659 2013 The CSF3R T618I mutation causes a lethal neutrophilic neoplasia in mice that is responsive to therapeutic JAK inhibition.
23897249 2013 GCSF-R expression in myelodysplastic and myeloproliferative disorders and blast dysmaturation in CML.
23820376 2013 E3 ubiquitin ligase Fbw7 negatively regulates granulocytic differentiation by targeting G-CSFR for degradation.
23774674 2013 Mutation of the colony-stimulating factor-3 receptor gene is a rare event with poor prognosis in chronic myelomonocytic leukemia.
23687340 2013 G-CSF receptor positive neuroblastoma subpopulations are enriched in chemotherapy-resistant or relapsed tumors and are highly tumorigenic.
23656643 2013 Oncogenic CSF3R mutations in chronic neutrophilic leukemia and atypical CML.
23508011 2013 Prevalence of a new auto-activating colony stimulating factor 3 receptor mutation (CSF3R-T595I) in acute myeloid leukemia and severe congenital neutropenia.
23159284 2013 The effect of granulocyte colony stimulating factor receptor gene missense single nucleotide polymorphisms on peripheral blood stem cell enrichment.
22796466 2012 Genetic variant of the G-CSF receptor gene is associated with lower mobilization potential and slower recovery of granulocytes after transplantation of autologous peripheral blood progenitor cells.
22146088 2012 An acquired CSF3R mutation in an adult chronic idiopathic neutropenia patient who developed acute myeloid leukaemia.
21641233 2011 Effects of interferon-? and granulocyte colony-stimulating factor on antifungal activity of human polymorphonuclear neutrophils against Candida albicans grown as biofilms or planktonic cells.
21129254 2010 [Effect of gemcitabine on granulocyte colony-stimulating factor receptor and bcr/abl mRNA in patients with chronic myeloid leukemia].
20819538 2010 Expression of CD123 and CD114 on the bone marrow cells of patients with myelodysplastic syndrome.
20696205 2010 Most purported antibodies to the human granulocyte colony-stimulating factor receptor are not specific.
20654748 2010 High-density polymorphisms analysis of 23 candidate genes for association with bone mineral density.
20557950 2010 Neuroprotective effect of Fn14 deficiency is associated with induction of the granulocyte-colony stimulating factor (G-CSF) pathway in experimental stroke and enhanced by a pathogenic human antiphospholipid antibody.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20471446 2010 MT1-MMP association with membrane lipid rafts facilitates G-CSF--induced hematopoietic stem/progenitor cell mobilization.
20237318 2010 G-CSF and its receptor in myeloid malignancy.
19833857 2009 RAS and CSF3R mutations in severe congenital neutropenia.
19794089 2009 G-CSF receptor (CSF3R) mutations in X-linked neutropenia evolving to acute myeloid leukemia or myelodysplasia.
19620628 2009 An activating mutation in the CSF3R gene induces a hereditary chronic neutrophilia.
19453968 2009 Site-specific ubiquitination determines lysosomal sorting and signal attenuation of the granulocyte colony-stimulating factor receptor.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19120359 2009 Clinical implications of ELA2-, HAX1-, and G-CSF-receptor (CSF3R) mutations in severe congenital neutropenia.
19099633 2008 [Expression of G-CSF and GM-CSF receptors on CD34 positive cells in aplastic anemia and myelodysplastic syndrome patients and its significance].
18923646 2008 G-CSFR ubiquitination critically regulates myeloid cell survival and proliferation.
18536571 2008 G-CSF receptor mutations in patients with congenital neutropenia.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17572226 2007 Granulocyte colony-stimulating factor/granulocyte colony-stimulating factor receptor biological axis promotes survival and growth of bladder cancer cells.
17494858 2007 Distinct patterns of mutations occurring in de novo AML versus AML arising in the setting of severe congenital neutropenia.
17363902 2007 Suppressor of cytokine signaling 3 controls lysosomal routing of G-CSF receptor.
17187068 2007 HAX1 deficiency causes autosomal recessive severe congenital neutropenia (Kostmann disease).
17127321 2007 Granulocyte colony-stimulating factor and its receptor in normal myeloid cell development, leukemia and related blood cell disorders.
17047971 2007 Granulocyte-colony stimulating factor (G-CSF) and G-CSF receptor expression in human ischemic stroke.
17024119 2006 Association with the single-nucleotide polymorphism (Glu785Lys) of the granulocyte colony-stimulating factor receptor with myelodysplastic syndromes and acute myeloid leukemia with multlineage dysplasia.
16985178 2007 Incidence of CSF3R mutations in severe congenital neutropenia and relevance for leukemogenesis: Results of a long-term survey.
16493051 2006 Unique structural determinants for Stat3 recruitment and activation by the granulocyte colony-stimulating factor receptor at phosphotyrosine ligands 704 and 744.
16492764 2006 Homodimeric cross-over structure of the human granulocyte colony-stimulating factor (GCSF) receptor signaling complex.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16033816 2005 Tyrosine 729 of the G-CSF receptor controls the duration of receptor signaling: involvement of SOCS3 and SOCS1.
15644419 2005 A functional single-nucleotide polymorphism of the G-CSF receptor gene predisposes individuals to high-risk myelodysplastic syndrome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15470047 2004 Loss of SHIP and CIS recruitment to the granulocyte colony-stimulating factor receptor contribute to hyperproliferative responses in severe congenital neutropenia/acute myelogenous leukemia.
15370243 2004 Granulocyte colony-stimulating factor receptors on CD34++ cells in patients with myelodysplastic syndrome (MDS) and MDS-acute myeloid leukemia.
15123426 2004 Regulation of LIP level and ROS formation through interaction of H-ferritin with G-CSF receptor.
14992583 2004 Thermodynamic analysis of the activation mechanism of the GCSF receptor induced by ligand binding.
14751388 2004 Granulocyte colony-stimulating factor receptor signals for beta1-integrin expression and adhesion in bladder cancer.
14737106 2004 C/EBPalphap30, a myeloid leukemia oncoprotein, limits G-CSF receptor expression but not terminal granulopoiesis via site-selective inhibition of C/EBP DNA binding.
14587040 2003 Proteolytic cleavage of granulocyte colony-stimulating factor and its receptor by neutrophil elastase induces growth inhibition and decreased cell surface expression of the granulocyte colony-stimulating factor receptor.
14557262 2004 Contribution of the membrane-distal tyrosine in intracellular signaling by the granulocyte colony-stimulating factor receptor.
12660437 2003 Messenger RNA expression of granulocyte colony-stimulating factor receptor isoforms in the fetus.
12586631 2003 The carboxy-terminal region of the granulocyte colony-stimulating factor receptor transduces a phagocytic signal.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12422946 2002 Defects of granulopoiesis in patients with severe congenital neutropenia.
12133942 2002 Suppressor of cytokine signaling-3 is recruited to the activated granulocyte-colony stimulating factor receptor and modulates its signal transduction.
12100165 2002 Characterization of granulocyte colony-stimulating factor receptor expressed on human lymphocytes.
12012328 2002 Novel variant isoform of G-CSF receptor involved in induction of proliferation of FDCP-2 cells: relevance to the pathogenesis of myelodysplastic syndrome.
11920194 2000 STAT3beta does not interfere with granulocyte colony-stimulating factor-induced neutrophilic differentiation.
11911419 Expression of G-CSF receptor on myeloid progenitors.
11468284 2001 Identification of ligand-binding site III on the immunoglobulin-like domain of the granulocyte colony-stimulating factor receptor.
10837195 2000 Granulocyte colony-stimulating factor receptors on granulocytes are down-regulated after endotoxin administration to healthy humans.
10729720 2000 Decreased mRNA expression of G-CSF receptor in cord blood neutrophils of term newborns: regulation of expression by G-CSF and TNF-alpha.
10449521 1999 Novel point mutation in the extracellular domain of the granulocyte colony-stimulating factor (G-CSF) receptor in a case of severe congenital neutropenia hyporesponsive to G-CSF treatment.
10364174 1999 Interaction of granulocyte colony-stimulating factor (G-CSF) with its receptor. Evidence that Glu19 of G-CSF interacts with Arg288 of the receptor.
9864141 1999 Identification of a novel Stat3 recruitment and activation motif within the granulocyte colony-stimulating factor receptor.
9824671 1998 Direct binding of Shc, Grb2, SHP-2 and p40 to the murine granulocyte colony-stimulating factor receptor.
9790917 1998 The Src-like tyrosine kinase Hck is activated by granulocyte colony-stimulating factor (G-CSF) and docks to the activated G-CSF receptor.
9368043 1997 Identification of a ligand-binding site on the granulocyte colony-stimulating factor receptor by molecular modeling and mutagenesis.
9187659 1997 Solution structure of an extracellular domain containing the WSxWS motif of the granulocyte colony-stimulating factor receptor and its interaction with ligand.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8855939 1996 Disulfide structure and N-glycosylation sites of an extracellular domain of granulocyte-colony stimulating factor receptor.
8708536 1996 Expression of granulocyte-colony stimulating factor and its receptor is regulated during the development of the human placenta.
8664280 1996 Dimerization of the extracellular domain of granuloycte-colony stimulating factor receptor by ligand binding: a monovalent ligand induces 2:2 complexes.
8554326 1995 Extracellular domain of granulocyte-colony stimulating factor receptor. Interaction with its ligand and identification of a domain in close proximity of ligand-binding region.
8197119 1994 Granulocyte colony-stimulating factor receptor signaling involves the formation of a three-component complex with Lyn and Syk protein-tyrosine kinases.
7775438 1995 The amino-terminal portion of the JAK2 protein kinase is necessary for binding and phosphorylation of the granulocyte-macrophage colony-stimulating factor receptor beta c chain.
7682568 1993 Identification of a functional receptor for granulocyte colony-stimulating factor on platelets.
7542747 1995 Mutations in the gene for the granulocyte colony-stimulating-factor receptor in patients with acute myeloid leukemia preceded by severe congenital neutropenia.
7514305 1994 Identification of a nonsense mutation in the granulocyte-colony-stimulating factor receptor in severe congenital neutropenia.
7512720 1994 Tyrosine kinase JAK1 is associated with the granulocyte-colony-stimulating factor receptor and both become tyrosine-phosphorylated after receptor activation.
2480598 1989 Identification and characterization of receptors for granulocyte colony-stimulating factor on human placenta and trophoblastic cells.
2147944 1990 Expression cloning of a human granulocyte colony-stimulating factor receptor: a structural mosaic of hematopoietin receptor, immunoglobulin, and fibronectin domains.
1833306 1991 Assignment of the human granulocyte colony-stimulating factor receptor gene (CSF3R) to chromosome 1 at region p35-p34.3.
1717255 1991 Functional domains of the granulocyte colony-stimulating factor receptor.
1701053 1990 Three different mRNAs encoding human granulocyte colony-stimulating factor receptor.
1530796 1992 Chromosomal gene organization of the human granulocyte colony-stimulating factor receptor.
1371413 1992 Molecular cloning of cDNAs for the human granulocyte colony-stimulating factor receptor from HL-60 and mapping of the gene to chromosome region 1p32-34.