Property Summary

NCBI Gene PubMed Count 39
PubMed Score 28.03
PubTator Score 26.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer 2.200 3.5e-02
intraductal papillary-mucinous neoplasm ... -1.100 2.2e-02
Multiple myeloma 2.618 2.7e-04
osteosarcoma 1.757 7.2e-09
ovarian cancer -1.500 3.2e-06
pancreatic ductal adenocarcinoma liver m... -1.569 4.1e-02
psoriasis -1.100 3.1e-03

Gene RIF (15)

AA Sequence

MSFDPNLLHNNGHNGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNLQDLKVGDDVE      1 - 70
FEVSSDRRTGKPIAVKLVKIKQEILPEERMNGQVVCAVPHNLESKSPAAPGQSPTGSVCYERNGEVFYLT     71 - 140
YTPEDVEGNVQLETGDKINFVIDNNKHTGAVSARNIMLLKKKQARCQGVVCAMKEAFGFIERGDVVKEIF    141 - 210
FHYSEFKGDLETLQPGDDVEFTIKDRNGKEVATDVRLLPQGTVIFEDISIEHFEGTVTKVIPKVPSKNQN    211 - 280
DPLPGRIKVDFVIPKELPFGDKDTKSKVTLLEGDHVRFNISTDRRDKLERATNIEVLSNTFQFTNEAREM    281 - 350
GVIAAMRDGFGFIKCVDRDVRMFFHFSEILDGNQLHIADEVEFTVVPDMLSAQRNHAIRIKKLPKGTVSF    351 - 420
HSHSDHRFLGTVEKEATFSNPKTTSPNKGKEKEAEDGIIAYDDCGVKLTIAFQAKDVEGSTSPQIGDKVE    421 - 490
FSISDKQRPGQQVATCVRLLGRNSNSKRLLGYVATLKDNFGFIETANHDKEIFFHYSEFSGDVDSLELGD    491 - 560
MVEYSLSKGKGNKVSAEKVNKTHSVNGITEEADPTIYSGKVIRPLRSVDPTQTEYQGMIEIVEEGDMKGE    561 - 630
VYPFGIVGMANKGDCLQKGESVKFQLCVLGQNAQTMAYNITPLRRATVECVKDQFGFINYEVGDSKKLFF    631 - 700
HVKEVQDGIELQAGDEVEFSVILNQRTGKCSACNVWRVCEGPKAVAAPRPDRLVNRLKNITLDDASAPRL    701 - 770
MVLRQPRGPDNSMGFGAERKIRQAGVID                                              771 - 798
//

Text Mined References (52)

PMID Year Title