Property Summary

NCBI Gene PubMed Count 47
PubMed Score 27.24
PubTator Score 38.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer -2.300 6.6e-05
ovarian cancer -1.600 1.1e-07
pituitary cancer 1.100 7.6e-03

Gene RIF (25)

AA Sequence

METQAEQQELETLPTTKMAQTNPTPGSLGPWKITIYDQENFQGKRMEFTSSCPNVSERSFDNVRSLKVES      1 - 70
GAWIGYEHTSFCGQQFILERGEYPRWDAWSGSNAYHIERLMSFRPICSANHKESKMTIFEKENFIGRQWE     71 - 140
ISDDYPSLQAMGWFNNEVGSMKIQSGAWVCYQYPGYRGYQYILECDHHGGDYKHWREWGSHAQTSQIQSI    141 - 210
RRIQQ                                                                     211 - 215
//

Text Mined References (47)

PMID Year Title