Property Summary

NCBI Gene PubMed Count 147
PubMed Score 159.99
PubTator Score 140.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.400 4.8e-03
ependymoma 1.300 1.6e-02
group 4 medulloblastoma 1.300 8.0e-04
medulloblastoma, large-cell 1.500 1.1e-04
oligodendroglioma 1.700 4.7e-03
osteosarcoma 1.789 2.2e-05
ovarian cancer -1.100 1.3e-03

Protein-protein Interaction (1)

Gene RIF (65)

AA Sequence

MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRR      1 - 70
FKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPTAEDNLEYVRTLYDFPGNDAE     71 - 140
DLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQP    141 - 210
QTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVN    211 - 280
GRKGLFPFTHVKIFDPQNPDENE                                                   281 - 303
//

Text Mined References (153)

PMID Year Title