Property Summary

NCBI Gene PubMed Count 98
PubMed Score 260.63
PubTator Score 150.99

Knowledge Summary

Patent (22,270)

Expression

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (81)

AA Sequence

MDAALLHSLLEANCSLALAEELLLDGWGPPLDPEGPYSYCNTTLDQIGTCWPRSAAGALVERPCPEYFNG      1 - 70
VKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHYRIALVVNYLGHCVSVAALVAAFLLFLA     71 - 140
LRSIRCLRNVIHWNLITTFILRNVMWFLLQLVDHEVHESNEVWCRCITTIFNYFVVTNFFWMFVEGCYLH    141 - 210
TAIVMTYSTERLRKCLFLFIGWCIPFPIIVAWAIGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLLINF    211 - 280
VFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIMFIYFNSFLQSF    281 - 350
QGFFVSVFYCFFNGEVRSAVRKRWHRWQDHHSLRVPMARAMSIPTSPTRISFHSIKQTAAV             351 - 411
//

Text Mined References (100)

PMID Year Title