Property Summary

NCBI Gene PubMed Count 193
PubMed Score 2279.88
PubTator Score 1220.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Rheumatoid Arthritis 1.900 2.8e-02
Waldenstrons macroglobulinemia -1.101 1.8e-02
chronic lymphosyte leukemia -2.600 8.1e-12
osteosarcoma -3.685 1.1e-04
tuberculosis 3.100 1.4e-07
interstitial cystitis 2.700 8.1e-06
primary Sjogren syndrome 1.500 1.3e-02
nasopharyngeal carcinoma -2.000 2.7e-04
lung carcinoma -1.800 3.2e-15
mucosa-associated lymphoid tissue lympho... 2.829 1.3e-02
ulcerative colitis 2.300 1.8e-04
ovarian cancer -1.600 7.0e-05
axial spondyloarthropathy 1.100 4.1e-02

Protein-protein Interaction (3)

Gene RIF (151)

PMID Text
26914463 the Putative Role of CR1 in Alzheimer's Disease
26650353 CyaA binding did not trigger downstream signaling of CR3 in human monocytes and CyaA-catalyzed elevation of cAMP effectively blocked CR3 signaling initiated by a natural ligand.
26273660 The C4d/CR1 ratio is a simple and quickly determinable biomarker that enables the differentiation between infection and flare-up in febrile SLE patients at initial evaluation.
26260209 These results provide a framework for understanding how loss of CR1 expression on podocytes may contribute to complement-mediated damage in the kidney.
26189291 THE COMBINATION OF EXPRESSION OF MARKERS CR1 AND CR2 (CD35/CD21) IN DIAGNOSTIC OF B-CELL LYMPHOPROLIFERATIVE DISEASES
25916414 Knops blood group antigen a/b genotype was associated with increased susceptibility to severe malaria and the b/b genotype was associated with reduced risk of severe malaria.
25742728 Complement receptor type 1 (CR1/CD35) expressed on activated human CD4+ T cells contributes to generation of regulatory T cells
25683978 CR1 gene rs2274567 G/A, rs4844600 G/A, and rs2296160 C/T polymorphisms may not be involved in susceptibility to malaria in Chinese population.
25494101 findings provide evidence that the A carrier (AG/GG) and the A allele of the ECR1 A3650G polymorphism may be correlated to the pathogenesis of NRDS and, hence, might be involved in the susceptibility to NRDS.
25349208 Data indicate that complement activation promote complement component 3 C3b deposition on native and acetylated LDL and binding to the complement receptor 1 (CR1).
24998857 In addition to being a risk factor for Alzheimer's disease development, a CR1 SNP appears to be associated with higher rates of medium-term disease progression
24996192 A meta-analysis demonstrated significant associations of both the CR1 rs6656401 and CR1 rs3818361 polymorphisms with late-onset Alzheimer's disease susceptibility.
24878768 This meta-analysis further supports previous findings that CR1 rs6656401 polymorphism contributes to Alzheimer's Disease susceptibility.
24621201 CR1 rs7525160 G > C polymorphism was associated with an increased risk of developing non-small cell lung cancer in Chinese population
24530172 CR1 SNPs correlates with specific aspects of cognitive impairment in Alzheimer's disease patients.
24433281 this is the first study to elucidate the relationship of the L-CR1 transcript with the disease activity of RA patients.
24214979 Using mutagenesis and structural biology to map the binding site for the Plasmodium falciparum merozoite protein PfRh4 on the human immune adherence receptor.
24162774 HIV-1 gp120 downregulates the expression of complement component receptor 1 (CR1) in human B cells
24038027 Polymorphism of the complement receptor 1 gene correlates with the hematologic response to eculizumab in patients with paroxysmal nocturnal hemoglobinuria.
24022490 ATP release following CR1 ligation increases the mobility of the lipid fraction of RBC membranes, which in turn facilitates CR1 clustering, and thereby enhances the binding avidity of complement-opsonized particles to the RBC CR1.
23898208 HIV-1 gp120 downregulates the expression of complement component receptor 1 (CR1) in human B cells
23650005 Genome-wide association studies found 3 new susceptibility loci for Alzheimer disease(AD): complement receptor 1,clusterin,and the phosphatidylinositol-binding clathrin assembly protein. These SNPS are not associated with AD in a Polish population.
23643458 This study identified nominally significant or suggestive associations between the LOAD-risky CR1 variants and worse Logical Memory immediate recall scores in blacks.
23591632 Maternal coding variants in complement receptor 1 is associated with spontaneous idiopathic preterm birth.
23582656 It did not explain (part of) the association of genome wide association top single-nucleotide polymorphisms rs3818361/rs6656401, nor of the CR1copy number variation, with Alzheimer disease in our cohort
23464487 Increased CR1 expression was associated with histology classification.
23440418 Malaria inhibits surface expression of complement receptor 1 in monocytes/macrophages, causing decreased immune complex internalization.
23416052 The CD35 antigen bounds gp350/220 and became latently infected when the fusion receptor HLA II was coexpressed.
23390291 There are fewer mono- or dinucleated, but dramatically more numbers of tri- or polynucleated megakaryocytes in the bone marrow of transgenic Crry mice.
23376460 Data show that increased CD35, CD46, CD55 and CD59 on neutrophils and monocytes present potent markers of bacterial infection and viral infection.
23202439 We identified rare small events overlapping CR1 and BIN1 in Alzheimer's disease and normal controls with opposite copy number variation dosage.
23152904 Common CR1 variants significantly protect against severe malaria in an endemic area.
23022416 Our findings suggest complex mechanisms underlying the interaction of CR1, APOE, and brain amyloid pathways in Alzheimer disease
22962438 Complement receptor type 1 (CR1, CD35) is a potent inhibitor of B-cell functions in rheumatoid arthritis patients.
22960360 In conclusion, despite there are some limitations, this meta-analysis indicates that the A allele of the CR1 SNP rs6656401 is significantly associated with LOAD susceptibility in Chinese Han populations.
22952074 CLU and CR1 were associated with more rapid cognitive decline. PICALM was associated with an earlier age at midpoint of cognitive decline.
22888138 CR1 (CD35) and CR3 (CD11b/CD18) act in concert for phagocytosis of opsonized Francisella tularensis by human neutrophils.
22819390 our results support that the CR1-S isoform explains the GWAS signals and open a novel prospect for the investigation of CR1-related disease mechanisms.
22539578 The SNP genotype pattern at the CR1 gene is associated with episodic memory.
22402018 In conclusion, we confirmed association of CLU, CR1, and PICALM genes with the disease status in our cohort through identification of a number of disease-specific variants
22374251 The clustering phenomenon of CR1 in erythrocytes is identified in electron microscopy.
22343410 identify a CR1 coding variant that influences episodic memory decline; it is a variant known to alter the conformation of CR1
22333472 HL and LL genotypes of CR1 gene may be associated with idiopathic pulmonary fibrosis.
22262751 The CR1 variant rs6656401 influences risk and recurrence of cerebral amyloid angiopathy-intracerebral hemorrhage, as well as the severity of vascular amyloid deposition
22244847 two Alzheimer's disease-associated CR1 variants, rs6656401 and rs3818361, are associated with major recurrent depression in females in a population-based cohort using individuals from the Generation Scotland: Scottish Family Health Study
22237765 Simultaneous quantitative analysis of CD64 and CD35 expression on neutrophils might be useful to distinguish between bacterial and viral infections in rheumatoid arthritis patients.
22015308 findings showed evidence of CR1, CLU, and PICALM and late-onset Alzheimer's disease (LOAD) susceptibility in an independent southern Chinese population
21985366 findings suggest individuals with low CR1 expression are ill-equipped to clear immune complexes and prevent immune complexe-mediated stimulation of macrophages
21912625 relationship of Parkinson's disease with SNPs of CLU, CR1 and PICALM
21839519 complement-dependent binding of Gram-negative bacteria to erythrocyte CR1 decreases phagocytosis and oxidative burst by leukocytes in human whole blood
21784344 This study demonistrated that the complement receptor 1 gene may contribute to Alzheimer's disease risk, although its effect size could be smaller than previously estimated.
21727667 Data show no correlation between degree of expression of RBC surface receptors CR1, CD55 and CD59 with haemoglobin level, but CD55 expression was less in malaria cases than in healthy controls.
21726919 CR1 risk allele (A) carriers showed smaller local gray matter volume in the entorhinal cortex
21700265 Genetic variation in CR1 influences interindividual variation in erythrocyte sedimentation rate, highlighting an association between the innate immunity pathway and erythrocyte interactions.
21663961 Human soluble form complement receptor 1 (sCR1) and heparin were co-immobilized onto the surfaces of islet cells.
21659422 significance of leukocyte CR1 as a prognostic marker for SLE
21593778 these data support the role of malaria leading to positive selection of this CR1 haplotype in Sardinia.
21459435 Data show that soluble complement receptor 1 on islet cells inhibits complement activation and protects islets against attack by xenoreactive antibodies and complement.
21403675 The results of this study supported a role for CR1 in the pathogenesis of Alzheimer disease.
21391232 We therefore highlight 1 functional consequence of the CR1 susceptibility allele and generalize the role of this locus to cognitive aging in the general population.
21358043 CR1 variants are not associated with sporadic Alzheimer's disease in a population of Chinese patients.
21347408 variants in BIN1, CLU, CR1 or PICALM are associated with changes in the CSF levels of biomarkers
21300948 This study provides compelling independent evidence that genetic variants in CLU, CR1, and PICALM are genetically associated with risk for AD.
21251929 Plasmodium falciparum field isolates use CR1 as a receptor for invasion of erythrocytes.
20951238 Observational study of gene-disease association. (HuGE Navigator)
20889874 Polymorphisms of CR1 are not associated with significant protection against P. falciparum blood-stage infection or uncomplicated malaria in school-aged children.
20855594 These results demonstrate that CR1 is an erythrocyte receptor used by the parasite ligand PfRh4 for P. falciparum invasion.
20795311 The physiology and molecular basis of the Knops blood group antigen CR1 is discussed. Review.
20739100 Observational study of gene-disease association. (HuGE Navigator)
20702729 Human CR1 transgenic mice lacking plasma, platelet, and podocyte factor H spontaneously develop proliferative glomerulonephritis, which is accelerated in a chronic serum sickness model.
20697030 This study confirmed in a completely independent data set that CR1, CLU, and PICALM are AD susceptibility loci in European ancestry populations.
20697030 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20674675 In this review, CR1 is a major Alzheimer disease susceptibility gene that is implicated directly in the herpes simplex virus life cycle and plays a general role in pathogen defense.
20670356 Observational study of genotype prevalence. (HuGE Navigator)
20646210 The level of CD35 was significantly elevated in patients with severe Mycoplasma infection.
20558387 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20558149 This study provides the evidence that variations in the CR1 gene play an important role in the pathogenesis of sporadic late-onset Alzheimer's disease in the Han Chinese population.
20558149 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20554627 These results show near-perfect replication and provide the first additional evidence that CR1 is associated with the risk of late onset alzheimer disease.
20554627 Observational study of gene-disease association. (HuGE Navigator)
20538029 Results suggest strong association between the CR1 C5507G gene polymorphism and cardiovascular disease in end-stage renal disease patients.
20538029 Observational study of gene-disease association. (HuGE Navigator)
20534741 Data confirmed genetic associations for Alzheimer's disease with APOE, CLU, PICALM and CR1 SNPs.
20534741 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20459687 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19959855 process of rosetting in the Indian context could be occurring independently of the effect of Knops polymorphism and in part could be controlled by other polymorphisms of the CR1 gene.
19959855 Observational study of gene-disease association. (HuGE Navigator)
19906204 CR1 A(3650)G RsaI polymorphism plays an important role in conferring genetic susceptibility to gallbladder cancer in north Indian population.
19906204 Observational study of gene-disease association. (HuGE Navigator)
19874218 In this review of CR1, the receptor for C3b/C4b complement peptides has emerged as a molecule of immense interest in gaining insight to the susceptibility, pathophysiology, diagnosis, prognosis and therapy of autoimmune and inflammatory diseases.
19734903 Two loci gave replicated evidence of association with Alzheimer's disease: one within CLU on chromosome 8 and the other within CR1 on chromosome 1.
19734903 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19578791 Data showed a possible involvement of CR1 gene polymorphisms in the predisposition to the development of CAD.
19480840 Resutls show that populations of the endemic region have very low red blood cell surface CR1 levels and higher frequencies of the exon 22 and intron 27 mutant L alleles.
19480840 Observational study of gene-disease association. (HuGE Navigator)
19344414 Observational study of gene-disease association. (HuGE Navigator)
19131551 Human erythrocytes bind and inactivate type 5 adenovirus by presenting Coxsackie virus-adenovirus receptor and complement receptor 1.
19048480 Genetic polymorphisms in CR1 genes are not associated with malaria resistance in patients from Baixo Amazonas region, Brazil
19048480 Observational study of gene-disease association. (HuGE Navigator)
18954403 Expression levels of CD47, CD35, CD55, and CD59 on red blood cells and signal-regulatory protein-alpha,beta on monocytes from patients with warm autoimmune hemolytic anemia.
18954261 A CR1 promoter allele, associated with higher E-CR1 expression, that conferred protection against cerebral malaria, is described.
18954261 Observational study of gene-disease association. (HuGE Navigator)
18937792 the association of the CR1 C5507G polymorphism with susceptibility to IPF was not reproducible in Czech and English populations.
18937792 Observational study of gene-disease association. (HuGE Navigator)
18929826 Measurement of the complement C4d/erythrocyte complement receptor 1 ratio may be a noninvasive method for detecting acute rejection after cardiac transplantation.
18842294 Observational study of gene-disease association. (HuGE Navigator)
18713965 REVIEW: comparison of CR1 protein structure, gene structure and function for mouse nad human
18709693 Within the SLE population, there was no association with disease activity and erythrocyte surface Complement Receptor 1 (CR1)
18684861 erythrocyte CR1 ligation induces its clustering in complex with scaffolding protein FAP-1
18434253 HH genotype is high in pulmonary tuberculosis patients and the reduced complement receptor 1 in patients may be an acquired phenomenon related to disease pathogenesis.
18182380 We demonstrate that the expression of the inhibitory receptors Fc gamma RII and CR1 is up-regulated on peripheral memory B cells of healthy controls, whereas this up-regulation is considerably impaired on the memory B cells of SLE patients.
18075277 A reduced erythrocyte CR1 level may be a risk factor for reduced host defense and can be used as a predicting factor for poor prognosis in hemodialysis patients.
18028942 The partly folded back solution structure of the 30 SCR domains in human CR1 permits access to its C3b and C4b ligands.
17999656 Susceptibility to sarcoidosis or its clinical course is not associated with the presence of the complement receptor 1 (CR1)5507*G allele in Czech and Dutch patients.
17709521 Observational study of gene-disease association. (HuGE Navigator)
17467802 A CR1 single nucleotide polymorphism (1597C>T) was identified that results in an additional cysteine (483R>C) in short consensus repeats 8 of the N-terminal C3b/C4b binding domain.
16433910 The expression of CR1 on neutrophils of patients with community-acquired viral or bacterial pneumonia is reported.
16426237 We identified several novel polymorphisms; however, the mutations did not segregate with erythrocyte CR1 expression level or the H and L alleles.
16360013 triggering CR1 inhibits proliferation of T-lymphocytes by a mechanism operating downstream of the initial signalling events
16289666 Occurrence of a reduced number/density of CR1 on erythrocytes of systemic lupus erythematosus (SLE) patients does not appear related to disease activity in SLE; coating of the complexes with complement is sufficient to bind them preferentially to CR1.
16277654 Observational study of gene-disease association. (HuGE Navigator)
16277654 The effect of the presence of the Sl2 and McCb alleles of the Swain-Langley and McCoy blood group antigens of CR1 on plasmodium malaria resistance are reported.
16133175 Meta-analysis of gene-disease association. (HuGE Navigator)
15864913 The expression of leukocyte CR1 at transcriptional level was correlated with the levels of serum CIC, C3 and anti dsDNA antibodies in SLE.
15733500 Observational study of gene-disease association. (HuGE Navigator)
15728520 In an in vitro model in which red cells with antibodies and complement bound to CR1 are incubated with THP-1 model macrophages, an unusual binding pattern is characterized by rearrangement and unclustering of CR1.
15660833 Several CR1-truncated soluble proteins were prepared and tested for their ability to prevent complement-mediated RBC destruction in vitro and in mice.
15578041 Observational study of genotype prevalence. (HuGE Navigator)
15529364 abnormally high levels of erythrocyte C4d and low levels of erythrocyte CR1 are characteristic of systemic lupus erythematosus
15526369 The changes in CR1 quantitative expression and adhering activity are consanguineously related to the development and metastasis in gallbladder carcinoma.
15388259 process in which C3b-opsonized substrates, bound to erythrocyte CR1 by immune adherence, are transferred to acceptor phagocytes
15381817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15176657 Urinary CR1 is a potential marker for glomerular involvement in systemic lupus erythematosus
15163541 Reduced CR1 synthesis causes the low cell-surface CR1 expression in SLE. Increased proteolytic cleavage of leukocyte cell-surface CR1 may occur. Low leukocyte CR1 impairs phagocyte-mediated immune complex clearance & increase complement consumption.
15072851 Observational study of gene-disease association. (HuGE Navigator)
15069174 Observational study of gene-disease association. (HuGE Navigator)
14694201 CR1 deficiency occurs in up to 80% of healthy individuals from the malaria-endemic regions of Papua New Guinea. This CR1 deficiency is associated with polymorphisms in the CR1 gene and, with alpha-thalassemia, a common genetic disorder in Melanesia.
14635039 Complement receptors type 1 (CR1, CD35) and 2 (CR2, CD21) cooperate in the binding of hydrolyzed complement factor 3 (C3i) to human B lymphocytes.
14556965 Observational study of genotype prevalence. (HuGE Navigator)
12869997 Observational study of gene-disease association. (HuGE Navigator)
12773320 Observational study of gene-disease association. (HuGE Navigator)
12490287 data suggest that erythrocyte cell surface domains rich in CR1, but not in DAF, are specifically lost in factor I deficiency
12486610 No relationship has been found between erythrocyte CR1 expression level and genotype for the HindIII restriction fragment length polymorphism when correlated with malaria susceptibility in West Africa.
12091241 Observational study of gene-disease association. (HuGE Navigator)
12091241 CR1 gene as a possible susceptibility factor in sarcoidosis.
12083416 The presence of CR1 (CD35) and CR4 (CD1c/CD18) on HUVEC indicates that endothelial cells (EC) have the potential to bind C3b and iC3b, respectively, which both mediate biological effects in the course of complement activation.
11981823 relative contributions of CR1 and CR2 to the deposition of C3 fragments and MAC on B lymphocytes under circumstances where all complement pathways are operational
11955431 The structure of the principal C3b/C4b binding site (residues 901-1095) of CR1 is reported, revealing three complement control protein modules (modules 15-17) in an extended head-to-tail arrangement with flexibility at the 16-17 junction
11884446 CR1 multimeric ligand inhibits the proliferation of tonsil B cells activated with a suboptimal dose of anti-IgM F(ab')2.

AA Sequence

MGASSPRSPEPVGPPAPGLPFCCGGSLLAVVVLLALPVAWGQCNAPEWLPFARPTNLTDEFEFPIGTYLN      1 - 70
YECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGS     71 - 140
SSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGE    141 - 210
PSIYCTSNDDQVGIWSGPAPQCIIPNKCTPPNVENGILVSDNRSLFSLNEVVEFRCQPGFVMKGPRRVKC    211 - 280
QALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCEPGYDLRGAASMRCTPQGDWSPAA    281 - 350
PTCEVKSCDDFMGQLLNGRVLFPVNLQLGAKVDFVCDEGFQLKGSSASYCVLAGMESLWNSSVPVCEQIF    351 - 420
CPSPPVIPNGRHTGKPLEVFPFGKTVNYTCDPHPDRGTSFDLIGESTIRCTSDPQGNGVWSSPAPRCGIL    421 - 490
GHCQAPDHFLFAKLKTQTNASDFPIGTSLKYECRPEYYGRPFSITCLDNLVWSSPKDVCKRKSCKTPPDP    491 - 560
VNGMVHVITDIQVGSRINYSCTTGHRLIGHSSAECILSGNAAHWSTKPPICQRIPCGLPPTIANGDFIST    561 - 630
NRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCIIPNKCTPPNVENGILVS    631 - 700
DNRSLFSLNEVVEFRCQPGFVMKGPRRVKCQALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQ    701 - 770
EVFYSCEPGYDLRGAASMRCTPQGDWSPAAPTCEVKSCDDFMGQLLNGRVLFPVNLQLGAKVDFVCDEGF    771 - 840
QLKGSSASYCVLAGMESLWNSSVPVCEQIFCPSPPVIPNGRHTGKPLEVFPFGKAVNYTCDPHPDRGTSF    841 - 910
DLIGESTIRCTSDPQGNGVWSSPAPRCGILGHCQAPDHFLFAKLKTQTNASDFPIGTSLKYECRPEYYGR    911 - 980
PFSITCLDNLVWSSPKDVCKRKSCKTPPDPVNGMVHVITDIQVGSRINYSCTTGHRLIGHSSAECILSGN    981 - 1050
TAHWSTKPPICQRIPCGLPPTIANGDFISTNRENFHYGSVVTYRCNLGSRGRKVFELVGEPSIYCTSNDD   1051 - 1120
QVGIWSGPAPQCIIPNKCTPPNVENGILVSDNRSLFSLNEVVEFRCQPGFVMKGPRRVKCQALNKWEPEL   1121 - 1190
PSCSRVCQPPPEILHGEHTPSHQDNFSPGQEVFYSCEPGYDLRGAASLHCTPQGDWSPEAPRCAVKSCDD   1191 - 1260
FLGQLPHGRVLFPLNLQLGAKVSFVCDEGFRLKGSSVSHCVLVGMRSLWNNSVPVCEHIFCPNPPAILNG   1261 - 1330
RHTGTPSGDIPYGKEISYTCDPHPDRGMTFNLIGESTIRCTSDPHGNGVWSSPAPRCELSVRAGHCKTPE   1331 - 1400
QFPFASPTIPINDFEFPVGTSLNYECRPGYFGKMFSISCLENLVWSSVEDNCRRKSCGPPPEPFNGMVHI   1401 - 1470
NTDTQFGSTVNYSCNEGFRLIGSPSTTCLVSGNNVTWDKKAPICEIISCEPPPTISNGDFYSNNRTSFHN   1471 - 1540
GTVVTYQCHTGPDGEQLFELVGERSIYCTSKDDQVGVWSSPPPRCISTNKCTAPEVENAIRVPGNRSFFS   1541 - 1610
LTEIIRFRCQPGFVMVGSHTVQCQTNGRWGPKLPHCSRVCQPPPEILHGEHTLSHQDNFSPGQEVFYSCE   1611 - 1680
PSYDLRGAASLHCTPQGDWSPEAPRCTVKSCDDFLGQLPHGRVLLPLNLQLGAKVSFVCDEGFRLKGRSA   1681 - 1750
SHCVLAGMKALWNSSVPVCEQIFCPNPPAILNGRHTGTPFGDIPYGKEISYACDTHPDRGMTFNLIGESS   1751 - 1820
IRCTSDPQGNGVWSSPAPRCELSVPAACPHPPKIQNGHYIGGHVSLYLPGMTISYICDPGYLLVGKGFIF   1821 - 1890
CTDQGIWSQLDHYCKEVNCSFPLFMNGISKELEMKKVYHYGDYVTLKCEDGYTLEGSPWSQCQADDRWDP   1891 - 1960
PLAKCTSRTHDALIVGTLSGTIFFILLIIFLSWIILKHRKGNNAHENPKEVAIHLHSQGGSSVHPRTLQT   1961 - 2030
NEENSRVLP                                                                2031 - 2039
//

Text Mined References (196)

PMID Year Title
26914463 2016 Analysis of the Putative Role of CR1 in Alzheimer's Disease: Genetic Association, Expression and Function.
26650353 2015 Bordetella adenylate cyclase toxin is a unique ligand of the integrin complement receptor 3.
26273660 2015 Analysis of Erythrocyte C4d to Complement Receptor 1 Ratio: Use in Distinguishing between Infection and Flare-Up in Febrile Patients with Systemic Lupus Erythematosus.
26260209 2015 Role of complement receptor 1 (CR1; CD35) on epithelial cells: A model for understanding complement-mediated damage in the kidney.
26189291 2015 [THE COMBINATION OF EXPRESSION OF MARKERS CR1 AND CR2 (CD35/CD21) IN DIAGNOSTIC OF B-CELL LYMPHOPROLIFERATIVE DISEASES].
25916414 2015 Severity of malaria in relation to a complement receptor 1 polymorphism: a case-control study.
25742728 2015 Complement receptor type 1 (CR1/CD35) expressed on activated human CD4+ T cells contributes to generation of regulatory T cells.
25683978 2015 Association of the single-nucleotide polymorphism and haplotype of the complement receptor 1 gene with malaria.
25494101 2015 Correlation of ECR1 A3650G polymorphism with neonatal respiratory distress syndrome.
25349208 2014 Differential complement activation pathways promote C3b deposition on native and acetylated LDL thereby inducing lipoprotein binding to the complement receptor 1.
24998857 2014 CR1 is potentially associated with rate of decline in sporadic Alzheimer's disease.
24996192 2014 Meta-analysis of the association between CR1 polymorphisms and risk of late-onset Alzheimer's disease.
24878768 2015 An Updated Analysis with 85,939 Samples Confirms the Association Between CR1 rs6656401 Polymorphism and Alzheimer's Disease.
24621201 2014 Tag SNPs in complement receptor-1 contribute to the susceptibility to non-small cell lung cancer.
24530172 2014 CR1, ABCA7, and APOE genes affect the features of cognitive impairment in Alzheimer's disease.
24433281 2014 Leucocyte complement receptor 1 (CR1/CD35) transcript and its correlation with the clinical disease activity in rheumatoid arthritis patients.
24214979 2014 Using mutagenesis and structural biology to map the binding site for the Plasmodium falciparum merozoite protein PfRh4 on the human immune adherence receptor.
24162737 2013 Meta-analysis of 74,046 individuals identifies 11 new susceptibility loci for Alzheimer's disease.
24038027 2014 Polymorphism of the complement receptor 1 gene correlates with the hematologic response to eculizumab in patients with paroxysmal nocturnal hemoglobinuria.
24022490 2013 CR1-mediated ATP release by human red blood cells promotes CR1 clustering and modulates the immune transfer process.
23650005 Lack of association of CR1, PICALM and CLU gene polymorphisms with Alzheimer disease in a Polish population.
23643458 2014 Evaluation of memory endophenotypes for association with CLU, CR1, and PICALM variants in black and white subjects.
23591632 2013 Maternal coding variants in complement receptor 1 and spontaneous idiopathic preterm birth.
23582656 2013 Complement receptor 1 coding variant p.Ser1610Thr in Alzheimer's disease and related endophenotypes.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23464487 2012 Complement receptor 1 expression in peripheral blood mononuclear cells and the association with clinicopathological features and prognosis of nasopharyngeal carcinoma.
23440418 2013 Malaria inhibits surface expression of complement receptor 1 in monocytes/macrophages, causing decreased immune complex internalization.
23416052 2013 Human complement receptor type 1/CD35 is an Epstein-Barr Virus receptor.
23390291 2013 Deletion of Crry and DAF on murine platelets stimulates thrombopoiesis and increases factor H-dependent resistance of peripheral platelets to complement attack.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23376460 2013 Use of complement regulators, CD35, CD46, CD55, and CD59, on leukocytes as markers for diagnosis of viral and bacterial infections.
23202439 2013 Genome-wide scan for copy number variation association with age at onset of Alzheimer's disease.
23152904 2012 Complement receptor 1 variants confer protection from severe malaria in Odisha, India.
23022416 2013 Effect of complement CR1 on brain amyloid burden during aging and its modification by APOE genotype.
22962438 2013 Complement receptor type 1 (CR1, CD35) is a potent inhibitor of B-cell functions in rheumatoid arthritis patients.
22960360 2012 Association of the CR1 polymorphism with late-onset Alzheimer's disease in Chinese Han populations: a meta-analysis.
22952074 2012 Effect of Alzheimer's disease risk genes on trajectories of cognitive function in the Cardiovascular Health Study.
22888138 2012 Natural IgM mediates complement-dependent uptake of Francisella tularensis by human neutrophils via complement receptors 1 and 3 in nonimmune serum.
22819390 2012 Genetic association of CR1 with Alzheimer's disease: a tentative disease mechanism.
22539578 2012 Genotype patterns at PICALM, CR1, BIN1, CLU, and APOE genes are associated with episodic memory.
22402018 2012 Implication of common and disease specific variants in CLU, CR1, and PICALM.
22374251 2012 Near-field quantification of complement receptor 1 (CR1/CD35) protein clustering in human erythrocytes.
22343410 2012 A coding variant in CR1 interacts with APOE-?4 to influence cognitive decline.
22333472 2011 [Association between genetic polymorphism of erythrocyte CR1 and the susceptibility of idiopathic pulmonary fibrosis].
22291609 2012 A genome-wide association scan on the levels of markers of inflammation in Sardinians reveals associations that underpin its complex regulation.
22262751 2012 Genetic variation at CR1 increases risk of cerebral amyloid angiopathy.
22244847 2012 Alzheimer's disease risk factor complement receptor 1 is associated with depression.
22237765 2012 Simultaneous quantitative analysis of the expression of CD64 and CD35 on neutrophils as markers to differentiate between bacterial and viral infections in patients with rheumatoid arthritis.
22015308 2012 Polymorphisms of CR1, CLU and PICALM confer susceptibility of Alzheimer's disease in a southern Chinese population.
21985366 2011 Dual role of erythrocyte complement receptor type 1 in immune complex-mediated macrophage stimulation: implications for the pathogenesis of Plasmodium falciparum malaria.
21912625 2011 An exploratory study on CLU, CR1 and PICALM and Parkinson disease.
21839519 2011 Neisseria meningitidis and Escherichia coli are protected from leukocyte phagocytosis by binding to erythrocyte complement receptor 1 in human blood.
21784344 2011 Genetic association of complement receptor 1 polymorphism rs3818361 in Alzheimer's disease.
21727667 2011 Anaemia & expression levels of CD35, CD55 & CD59 on red blood cells in Plasmodium falciparum malaria patients from India.
21726919 2011 CR1 genotype is associated with entorhinal cortex volume in young healthy adults.
21700265 2011 Complement receptor 1 gene variants are associated with erythrocyte sedimentation rate.
21663961 2011 Layer-by-layer co-immobilization of soluble complement receptor 1 and heparin on islets.
21659422 2011 Relationship of leukocyte CR1 transcript and protein with the pathophysiology and prognosis of systemic lupus erythematosus: a follow-up study.
21593778 2011 Evidence for malaria selection of a CR1 haplotype in Sardinia.
21460841 2011 Common variants at MS4A4/MS4A6E, CD2AP, CD33 and EPHA1 are associated with late-onset Alzheimer's disease.
21460840 2011 Common variants at ABCA7, MS4A6A/MS4A4E, EPHA1, CD33 and CD2AP are associated with Alzheimer's disease.
21459435 2011 Immobilization of soluble complement receptor 1 on islets.
21403675 2012 Alzheimer risk associated with a copy number variation in the complement receptor 1 increasing C3b/C4b binding sites.
21391232 2011 CR1 is associated with amyloid plaque burden and age-related cognitive decline.
21358043 2011 PICALM and CR1 variants are not associated with sporadic Alzheimer's disease in Chinese patients.
21347408 2011 Fine mapping of genetic variants in BIN1, CLU, CR1 and PICALM for association with cerebrospinal fluid biomarkers for Alzheimer's disease.
21300948 2011 The role of clusterin, complement receptor 1, and phosphatidylinositol binding clathrin assembly protein in Alzheimer disease risk and cerebrospinal fluid biomarker levels.
21251929 2011 Plasmodium falciparum field isolates use complement receptor 1 (CR1) as a receptor for invasion of erythrocytes.
20951238 2011 High CR1 level and related polymorphic variants are associated with cerebral malaria in eastern-India.
20889874 2010 Minimal association of common red blood cell polymorphisms with Plasmodium falciparum infection and uncomplicated malaria in Papua New Guinean school children.
20855594 2010 Complement receptor 1 is the host erythrocyte receptor for Plasmodium falciparum PfRh4 invasion ligand.
20795311 2010 The Knops blood-group system: a review.
20739100 2011 Genetic variations in the CLU and PICALM genes are associated with cognitive function in the oldest old.
20702729 2010 Abnormal immune complex processing and spontaneous glomerulonephritis in complement factor H-deficient mice with human complement receptor 1 on erythrocytes.
20697030 2010 Meta-analysis confirms CR1, CLU, and PICALM as alzheimer disease risk loci and reveals interactions with APOE genotypes.
20674675 2010 APP, APOE, complement receptor 1, clusterin and PICALM and their involvement in the herpes simplex life cycle.
20670356 2010 The polymorphism of the Knops blood group system among five Chinese ethnic groups.
20646210 2010 Overexpression of complement receptor type I (CR1, CD35) on erythrocytes in patients with hemoplasma infection.
20558387 2010 Genetic variation and neuroimaging measures in Alzheimer disease.
20558149 2010 Complement receptor 1 polymorphisms and risk of late-onset Alzheimer's disease.
20554627 2010 Replication of CLU, CR1, and PICALM associations with alzheimer disease.
20538029 2010 Complement receptor 1 gene polymorphism and cardiovascular disease in dialyzed end-stage renal disease patients.
20534741 2010 Association of CR1, CLU and PICALM with Alzheimer's disease in a cohort of clinically characterized and neuropathologically verified individuals.
20459687 2010 Candidate malaria susceptibility/protective SNPs in hospital and population-based studies: the effect of sub-structuring.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19959855 2009 Role of CR1 Knops polymorphism in the pathophysiology of malaria: Indian scenario.
19906204 2009 Complement receptor 1 (A3650G RsaI and intron 27 HindIII) polymorphisms and risk of gallbladder cancer in north Indian population.
19874218 2009 The structure, genetic polymorphisms, expression and biological functions of complement receptor type 1 (CR1/CD35).
19734903 2009 Genome-wide association study identifies variants at CLU and CR1 associated with Alzheimer's disease.
19578791 2009 CR1 genotype and haplotype involvement in coronary artery disease: the pivotal role of hypertension and dyslipidemia.
19480840 2009 CR1 levels and gene polymorphisms exhibit differential association with falciparum malaria in regions of varying disease endemicity.
19344414 2009 Risk of non-Hodgkin lymphoma in association with germline variation in complement genes.
19131551 2009 Human erythrocytes bind and inactivate type 5 adenovirus by presenting Coxsackie virus-adenovirus receptor and complement receptor 1.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19048480 2008 Genetic polymorphisms in TLR4, CR1 and Duffy genes are not associated with malaria resistance in patients from Baixo Amazonas region, Brazil.
18954403 2009 Expression levels of CD47, CD35, CD55, and CD59 on red blood cells and signal-regulatory protein-alpha,beta on monocytes from patients with warm autoimmune hemolytic anemia.
18954261 2008 A functional single-nucleotide polymorphism in the CR1 promoter region contributes to protection against cerebral malaria.
18937792 2008 The CR1 C5507G polymorphism is not involved in susceptibility to idiopathic pulmonary fibrosis in two European populations.
18929826 2008 Measurement of human erythrocyte C4d to erythrocyte complement receptor 1 ratio in cardiac transplant recipients with acute symptomatic allograft failure.
18842294 2008 Association between the SERPING1 gene and age-related macular degeneration: a two-stage case-control study.
18713965 2008 Comparative functional evolution of human and mouse CR1 and CR2.
18709693 2008 Erythrocyte C4d and complement receptor 1 in systemic lupus erythematosus.
18684861 2008 Ligation of erythrocyte CR1 induces its clustering in complex with scaffolding protein FAP-1.
18434253 2008 Reduced erythrocyte CR1 levels in patients with pulmonary tuberculosis is an acquired phenomenon.
18182380 2008 Physiological up-regulation of inhibitory receptors Fc gamma RII and CR1 on memory B cells is lacking in SLE patients.
18075277 2008 Low CR1 (C3b receptor) level on erythrocytes is associated with poor prognosis in hemodialysis patients.
18028942 2008 The partly folded back solution structure arrangement of the 30 SCR domains in human complement receptor type 1 (CR1) permits access to its C3b and C4b ligands.
17999656 2008 Complement receptor 1 single nucleotide polymorphisms in Czech and Dutch patients with sarcoidosis.
17709521 2007 Polymorphisms in genes involved in innate immunity predispose toward mycetoma susceptibility.
17467802 2007 A polymorphism in the type one complement receptor (CR1) involves an additional cysteine within the C3b/C4b binding domain that inhibits ligand binding.
17207243 2007 Knops blood group haplotypes among distinct Brazilian populations.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16433910 2006 Measurement of complement receptor 1 on neutrophils in bacterial and viral pneumonia.
16426237 2006 Erythrocyte complement receptor 1 (CR1) expression level is not associated with polymorphisms in the promoter or 3' untranslated regions of the CR1 gene.
16360013 2006 The complement receptor 1, CR1 (CD35), mediates inhibitory signals in human T-lymphocytes.
16289666 2005 CR1 on erythrocytes of Brazilian systemic lupus erythematosus patients: the influence of disease activity on expression and ability of this receptor to bind immune complexes opsonized with complement from normal human serum.
16277654 2005 Complement receptor 1 polymorphisms associated with resistance to severe malaria in Kenya.
16133175 2005 Polymorphisms of complement receptor 1 and interleukin-10 genes and systemic lupus erythematosus: a meta-analysis.
15864913 2005 Association of leukocyte CR1 gene transcription with the disease severity and renal involvement in systemic lupus erythematosus.
15733500 2005 The polymorphism C5507G of complement receptor 1 does not explain idiopathic pulmonary fibrosis among the Finns.
15728520 2005 Processing of C3b-opsonized immune complexes bound to non-complement receptor 1 (CR1) sites on red cells: phagocytosis, transfer, and associations with CR1.
15660833 2005 Characterization of complement receptor 1 domains for prevention of complement-mediated red cell destruction.
15578041 2005 A complement receptor-1 polymorphism with high frequency in malaria endemic regions of Asia but not Africa.
15529364 2004 Measurement of erythrocyte C4d and complement receptor 1 in systemic lupus erythematosus.
15526369 2004 Genomic determination of CR1 CD35 density polymorphism on erythrocytes of patients with gallbladder carcinoma.
15388259 2004 Staphylococcus aureus bound to complement receptor 1 on human erythrocytes by bispecific monoclonal antibodies is phagocytosed by acceptor macrophages.
15381817 2004 Large-scale candidate gene study of tuberculosis susceptibility in the Karonga district of northern Malawi.
15176657 2004 Modulation of urinary CR1 in systemic lupus erythematosus.
15163541 2004 Reduced complement receptor 1 (CR1, CD35) transcription in systemic lupus erythematosus.
15072851 2004 Association of complement receptor 1 (CR1, CD35, C3b/C4b receptor) density polymorphism with glomerulonephritis in Indian subjects.
15069174 2004 Quantitative polymorphism of complement receptor type 1 (CR1) in patients undergoing haemodialysis.
14694201 2004 A human complement receptor 1 polymorphism that reduces Plasmodium falciparum rosetting confers protection against severe malaria.
14635039 2003 Complement receptors type 1 (CR1, CD35) and 2 (CR2, CD21) cooperate in the binding of hydrolyzed complement factor 3 (C3i) to human B lymphocytes.
14556965 2003 Genetic and structural polymorphism of complement receptor 1 in normal Indian subjects.
12869997 2003 [Changes of ECR1 genomic density polymorphism, quantitative expression and the activity of ECR1 natural adhesion in patients with chronic hepatitis].
12773320 2003 Complement receptor 1 gene polymorphisms are associated with idiopathic pulmonary fibrosis.
12490287 The mechanism of loss of CR1 during maturation of erythrocytes is different between factor I deficient patients and healthy donors.
12486610 2002 Erythrocyte CR1 expression level does not correlate with a HindIII restriction fragment length polymorphism in Africans; implications for studies on malaria susceptibility.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12091241 2002 Complement receptor 1 gene polymorphisms in sarcoidosis.
12083416 2002 Human umbilical vein endothelial cells express complement receptor 1 (CD35) and complement receptor 4 (CD11c/CD18) in vitro.
11981823 2002 The role of complement receptors type 1 (CR1, CD35) and 2 (CR2, CD21) in promoting C3 fragment deposition and membrane attack complex formation on normal peripheral human B cells.
11955431 2002 Structure of the C3b binding site of CR1 (CD35), the immune adherence receptor.
11896343 2002 Expansion of the Knops blood group system and subdivision of Sl(a).
11694537 2002 Decay-accelerating factor (DAF), complement receptor 1 (CR1), and factor H dissociate the complement AP C3 convertase (C3bBb) via sites on the type A domain of Bb.
11313284 2001 Molecular identification of Knops blood group polymorphisms found in long homologous region D of complement receptor 1.
11120776 2000 Complement receptor 1/CD35 is a receptor for mannan-binding lectin.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10698335 The C3b/C4b receptor (CR1, CD35) on erythrocytes: methods for study of the polymorphisms.
10531307 1999 Decay accelerating activity of complement receptor type 1 (CD35). Two active sites are required for dissociating C5 convertases.
10528211 1999 C1q and C4b bind simultaneously to CR1 and additively support erythrocyte adhesion.
10528197 1999 Quantitative alleles of CR1: coding sequence analysis and comparison of haplotypes in two ethnic groups.
10382758 1999 Structure-activity relationships within the N-terminal short consensus repeats (SCR) of human CR1 (C3b/C4b receptor, CD35): SCR 3 plays a critical role in inhibition of the classical and alternative pathways of complement activation.
9988761 1999 Identification of residues within the 727-767 segment of human complement component C3 important for its interaction with factor H and with complement receptor 1 (CR1, CD35).
9614933 1998 Analysis of complement receptor type 1 (CR1) expression on erythrocytes and of CR1 allelic markers in Caucasian and African American populations.
9230440 1997 P. falciparum rosetting mediated by a parasite-variant erythrocyte membrane protein and complement-receptor 1.
9089986 1997 Analysis of Knops blood group antigens on CR1 (CD35) by the MAIEA test and by immunoblotting.
8706338 1996 Structural polymorphisms of complement receptor 1 (CR1) in systemic lupus erythematosus (SLE) patients and normal controls of three ethnic groups.
8422437 1993 The interaction of soluble human complement receptor type 1 (sCR1, BRL55730) with human complement component C4.
8245463 1993 Structure of the gene for the F allele of complement receptor type 1 and sequence of the coding region unique to the S allele.
6978375 1982 Complement receptor (CR1) deficiency in erythrocytes from patients with systemic lupus erythematosus.
6910481 1981 Complement receptor is an inhibitor of the complement cascade.
6572933 1983 Polymorphism of human erythrocyte C3b/C4b receptor.
6230413 1984 Polymorphism of the human C3b/C4b receptor. Identification of a third allele and analysis of receptor phenotypes in families and patients with systemic lupus erythematosus.
6223944 1983 Genetic regulation of a structural polymorphism of human C3b receptor.
6222138 1983 Structural heterogeneity of the C3b/C4b receptor (Cr 1) on human peripheral blood cells.
6126949 1982 Ultrastructural localization of human complement C3b receptors in the human kidney as determined by immunoperoxidase staining with the monoclonal antibody C3RTo5.
6115248 1981 Defective immune-adherence (C3b) receptor on erythrocytes from patients with systemic lupus erythematosus.
4019777 1985 Autoantibody to the C3b/C4b receptor and absence of this receptor from erythrocytes of a patient with systemic lupus erythematosus.
3782802 1987 A complement receptor locus: genes encoding C3b/C4b receptor and C3d/Epstein-Barr virus receptor map to 1q32.
3736743 1986 Two cases of mesangiocapillary glomerulonephritis with CR1 deficiency.
3305706 1987 Monoclonal antibodies that recognize lacto-N-fucopentaose III (CD15) react with the adhesion-promoting glycoprotein family (LFA-1/HMac-1/gp 150,95) and CR1 on human neutrophils.
3157763 1985 Human genes for three complement components that regulate the activation of C3 are tightly linked.
3156931 1985 Characterization of a soluble form of the C3b/C4b receptor (CR1) in human plasma.
3155774 1985 Polymorphism of the C3b/C4b receptor (CR1): characterization of a fourth allele.
3031685 1987 Human complement C3b/C4b receptor (CR1) mRNA polymorphism that correlates with the CR1 allelic molecular weight polymorphism.
3014040 1986 Identification of a restriction fragment length polymorphism by a CR1 cDNA that correlates with the number of CR1 on erythrocytes.
2989379 1985 Human complement receptors for C3b (CR1) and C3d (CR2).
2977721 1988 Assignment of complement components C4 binding protein (C4BP) and factor H (FH) to human chromosome 1q, using cDNA probes.
2972794 1988 Identification of distinct C3b and C4b recognition sites in the human C3b/C4b receptor (CR1, CD35) by deletion mutagenesis.
2971757 1988 Identification of an alternative polyadenylation site in the human C3b/C4b receptor (complement receptor type 1) transcriptional unit and prediction of a secreted form of complement receptor type 1.
2959289 1987 Inherited deficiency of erythrocyte complement receptor type 1 does not cause susceptibility to systemic lupus erythematosus.
2951479 1987 Human C3b/C4b receptor (CR1). Demonstration of long homologous repeating domains that are composed of the short consensus repeats characteristics of C3/C4 binding proteins.
2933745 1985 Identification of a partial cDNA clone for the human receptor for complement fragments C3b/C4b.
2877046 1986 Analysis of multiple restriction fragment length polymorphisms of the gene for the human complement receptor type I. Duplication of genomic sequences occurs in association with a high molecular mass receptor allotype.
2564414 1989 Structure of the human CR1 gene. Molecular basis of the structural and quantitative polymorphisms and identification of a new CR1-like allele.
2551147 1989 Structure and function of the complement receptors, CR1 (CD35) and CR2 (CD21).
2531419 1989 Immunoregulatory functions of complement: structural and functional studies of complement receptor type 1 (CR1; CD35) and type 2 (CR2; CD21).
2478758 1989 Human liver Kupffer cells express CR1, CR3, and CR4 complement receptor antigens. An immunohistochemical study.
2411809 1985 Human follicular dendritic cells express CR1, CR2, and CR3 complement receptor antigens.
2295627 1990 Duplication and divergence of the amino-terminal coding region of the complement receptor 1 (CR1) gene. An example of concerted (horizontal) evolution within a gene.
1827486 1991 Identification of human erythrocyte blood group antigens on the C3b/C4b receptor.
1708809 1991 The C3b/C4b receptor is recognized by the Knops, McCoy, Swain-langley, and York blood group antisera.
1708808 1991 Molecular interactions of complement receptors on B lymphocytes: a CR1/CR2 complex distinct from the CR2/CD19 complex.
1670949 1991 Proposed structure of the F' allotype of human CR1. Loss of a C3b binding site may be associated with altered function.