Property Summary

NCBI Gene PubMed Count 23
PubMed Score 49.81
PubTator Score 18.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
posterior fossa group B ependymoma -1.400 1.8e-05
glioblastoma -1.400 2.0e-03
medulloblastoma, large-cell -1.900 8.2e-04
adult high grade glioma -1.300 3.3e-04
lung carcinoma 1.900 4.1e-37
Pick disease -1.200 1.2e-04

Gene RIF (12)

PMID Text
26041663 CPT1c is found in brain regions that are related to food intake and neuropsychiatric disease. CPT1c affects ceramide levels, endocannabionoids, and oxidative processes and may play an important role in various brain functions such as learning.
25751282 CPT1C mutation associated with novel form of pure autosomal dominant hereditary spastic paraplegia.
25505242 The interaction of HIV-1 CA with human cellular carnitine palmitoyltransferase 1C protein (CPT1C) is identified by yeast two-hybrid screen
24618825 High grade glioblastoma is associated with increased level of ZFP57, a protein involved in gene imprinting, and aberrant expression of CPT1A and CPT1C.
21961029 Data suggest that an involvement of CPT1C in cellular energy-sensing pathways and provide evidence for a role of CPT1C in hypothalamic regulation of energy homeostasis.
21576264 cells can use a novel mechanism involving CPT1C and fatty acid metabolism to protect against metabolic stress
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18385088 Accumulation of 3-hydroxylated intermediates of long-chain fatty acids may contribute to the pathogenesis of retinopathy in MTP deficiencies.
18192268 CPT1c is localized in endoplasmic reticulum of neurons and has carnitine palmitoyltransferase activity
11095714 The interaction of HIV-1 CA with human cellular carnitine palmitoyltransferase 1C protein (CPT1C) is identified by yeast two-hybrid screen

AA Sequence

MAEAHQAVGFRPSLTSDGAEVELSAPVLQEIYLSGLRSWKRHLSRFWNDFLTGVFPASPLSWLFLFSAIQ      1 - 70
LAWFLQLDPSLGLMEKIKELLPDWGGQHHGLRGVLAAALFASCLWGALIFTLHVALRLLLSYHGWLLEPH     71 - 140
GAMSSPTKTWLALVRIFSGRHPMLFSYQRSLPRQPVPSVQDTVRKYLESVRPILSDEDFDWTAVLAQEFL    141 - 210
RLQASLLQWYLRLKSWWASNYVSDWWEEFVYLRSRNPLMVNSNYYMMDFLYVTPTPLQAARAGNAVHALL    211 - 280
LYRHRLNRQEIPPTLLMGMRPLCSAQYEKIFNTTRIPGVQKDYIRHLHDSQHVAVFHRGRFFRMGTHSRN    281 - 350
SLLSPRALEQQFQRILDDPSPACPHEEHLAALTAAPRGTWAQVRTSLKTQAAEALEAVEGAAFFVSLDAE    351 - 420
PAGLTREDPAASLDAYAHALLAGRGHDRWFDKSFTLIVFSNGKLGLSVEHSWADCPISGHMWEFTLATEC    421 - 490
FQLGYSTDGHCKGHPDPTLPQPQRLQWDLPDQIHSSISLALRGAKILSENVDCHVVPFSLFGKSFIRRCH    491 - 560
LSSDSFIQIALQLAHFRDRGQFCLTYESAMTRLFLEGRTETVRSCTREACNFVRAMEDKEKTDPQCLALF    561 - 630
RVAVDKHQALLKAAMSGQGVDRHLFALYIVSRFLHLQSPFLTQVHSEQWQLSTSQIPVQQMHLFDVHNYP    631 - 700
DYVSSGGGFGPADDHGYGVSYIFMGDGMITFHISSKKSSTKTDSHRLGQHIEDALLDVASLFQAGQHFKR    701 - 770
RFRGSGKENSRHRCGFLSRQTGASKASMTSTDF                                         771 - 803
//

Text Mined References (24)

PMID Year Title
26041663 2015 The Carnitine Palmitoyl Transferase (CPT) System and Possible Relevance for Neuropsychiatric and Neurological Conditions.
25751282 2015 Mutation in CPT1C Associated With Pure Autosomal Dominant Spastic Paraplegia.
24618825 2014 High grade glioblastoma is associated with aberrant expression of ZFP57, a protein involved in gene imprinting, and of CPT1A and CPT1C that regulate fatty acid metabolism.
21961029 2011 The CPT1C 5'UTR contains a repressing upstream open reading frame that is regulated by cellular energy availability and AMPK.
21576264 2011 Carnitine palmitoyltransferase 1C promotes cell survival and tumor growth under conditions of metabolic stress.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20864405 2010 Mechanisms of peripheral neuropathy associated with bortezomib and vincristine in patients with newly diagnosed multiple myeloma: a prospective analysis of data from the HOVON-65/GMMG-HD4 trial.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19694967 2010 Regulatory enzymes of mitochondrial beta-oxidation as targets for treatment of the metabolic syndrome.
18385088 2008 Carnitine palmitoyltransferase I and Acyl-CoA dehydrogenase 9 in retina: insights of retinopathy in mitochondrial trifunctional protein defects.
18192268 2008 CPT1c is localized in endoplasmic reticulum of neurons and has carnitine palmitoyltransferase activity.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17478525 2007 Fatty acid binding protein facilitates sarcolemmal fatty acid transport but not mitochondrial oxidation in rat and human skeletal muscle.
17018521 2006 The role of hypothalamic malonyl-CoA in energy homeostasis.
16778180 2006 Silencing of Peroxiredoxin 2 and aberrant methylation of 33 CpG islands in putative promoter regions in human malignant melanomas.
15613406 2005 Peroxisome proliferator activated receptor delta (PPARdelta) agonist but not PPARalpha corrects carnitine palmitoyl transferase 2 deficiency in human muscle cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15363638 Carnitine palmitoyltransferases 1 and 2: biochemical, molecular and medical aspects.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376098 2002 A novel brain-expressed protein related to carnitine palmitoyltransferase I.
11001805 Genomics of the human carnitine acyltransferase genes.