Property Summary

Ligand Count 472
NCBI Gene PubMed Count 82
PubMed Score 224.99
PubTator Score 208.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
ulcerative colitis 1819 1.3e-07
medulloblastoma, large-cell 6241 2.9e-06
psoriasis 6694 5.2e-06
ovarian cancer 8520 7.0e-06
group 3 medulloblastoma 4104 1.0e-03
astrocytoma 1146 5.5e-03
colon cancer 1478 1.2e-02
osteosarcoma 7950 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.200 5.5e-03
colon cancer -2.400 1.2e-02
group 3 medulloblastoma -1.200 1.0e-03
medulloblastoma, large-cell -1.900 2.9e-06
osteosarcoma -1.038 1.5e-02
ovarian cancer -1.100 7.0e-06
psoriasis -3.000 5.2e-06
ulcerative colitis -1.500 1.3e-07

Protein-protein Interaction (2)

Gene RIF (69)

AA Sequence

MAEAHQAVAFQFTVTPDGIDLRLSHEALRQIYLSGLHSWKKKFIRFKNGIITGVYPASPSSWLIVVVGVM      1 - 70
TTMYAKIDPSLGIIAKINRTLETANCMSSQTKNVVSGVLFGTGLWVALIVTMRYSLKVLLSYHGWMFTEH     71 - 140
GKMSRATKIWMGMVKIFSGRKPMLYSFQTSLPRLPVPAVKDTVNRYLQSVRPLMKEEDFKRMTALAQDFA    141 - 210
VGLGPRLQWYLKLKSWWATNYVSDWWEEYIYLRGRGPLMVNSNYYAMDLLYILPTHIQAARAGNAIHAIL    211 - 280
LYRRKLDREEIKPIRLLGSTIPLCSAQWERMFNTSRIPGEETDTIQHMRDSKHIVVYHRGRYFKVWLYHD    281 - 350
GRLLKPREMEQQMQRILDNTSEPQPGEARLAALTAGDRVPWARCRQAYFGRGKNKQSLDAVEKAAFFVTL    351 - 420
DETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMS    421 - 490
IDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIK    491 - 560
KCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRL    561 - 630
KLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLE    631 - 700
NNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPETDSHRFGRHLKEAMTDIITLFGLSSN    701 - 770
SKK                                                                       771 - 773
//

Text Mined References (84)

PMID Year Title