Property Summary

NCBI Gene PubMed Count 25
PubMed Score 27.33
PubTator Score 13.82

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.800 6.6e-06
medulloblastoma, large-cell 1.100 3.3e-05
osteosarcoma -1.751 1.7e-04
ovarian cancer 1.700 8.0e-05
primitive neuroectodermal tumor 1.100 2.3e-04
subependymal giant cell astrocytoma 1.169 5.9e-03

 MGI Phenotype (1)

Gene RIF (12)

AA Sequence

MSAIPAEESDQLLIRPLGAGQEVGRSCIILEFKGRKIMLDCGIHPGLEGMDALPYIDLIDPAEIDLLLIS      1 - 70
HFHLDHCGALPWFLQKTSFKGRTFMTHATKAIYRWLLSDYVKVSNISADDMLYTETDLEESMDKIETINF     71 - 140
HEVKEVAGIKFWCYHAGHVLGAAMFMIEIAGVKLLYTGDFSRQEDRHLMAAEIPNIKPDILIIESTYGTH    141 - 210
IHEKREEREARFCNTVHDIVNRGGRGLIPVFALGRAQELLLILDEYWQNHPELHDIPIYYASSLAKKCMA    211 - 280
VYQTYVNAMNDKIRKQININNPFVFKHISNLKSMDHFDDIGPSVVMASPGMMQSGLSRELFESWCTDKRN    281 - 350
GVIIAGYCVEGTLAKHIMSEPEEITTMSGQKLPLKMSVDYISFSAHTDYQQTSEFIRALKPPHVILVHGE    351 - 420
QNEMARLKAALIREYEDNDEVHIEVHNPRNTEAVTLNFRGEKLAKVMGFLADKKPEQGQRVSGILVKRNF    421 - 490
NYHILSPCDLSNYTDLAMSTVKQTQAIPYTGPFNLLCYQLQKLTGDVEELEIQEKPALKVFKNITVIQEP    491 - 560
GMVVLEWLANPSNDMYADTVTTVILEVQSNPKIRKGAVQKVSKKLEMHVYSKRLEIMLQDIFGEDCVSVK    561 - 630
DDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEALTPVH                    631 - 684
//

Text Mined References (36)

PMID Year Title