Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.97
PubTator Score 3.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 2.700 4.0e-08
astrocytic glioma -1.500 3.2e-02
ependymoma -1.200 4.5e-02
oligodendroglioma -1.100 3.4e-02
psoriasis -1.500 1.2e-03
osteosarcoma -1.941 2.4e-03
cystic fibrosis 1.704 3.3e-06
primary pancreatic ductal adenocarcinoma 1.030 4.3e-03
tuberculosis 3.000 7.3e-08
non-small cell lung cancer -1.268 5.4e-23
pilocytic astrocytoma 1.500 1.4e-05
aldosterone-producing adenoma -1.114 6.8e-03
spina bifida -1.134 3.8e-02
ovarian cancer -1.100 4.6e-04
pituitary cancer -1.100 1.4e-05

Gene RIF (2)

PMID Text
23939394 CPPED1 is involved in glucose uptake in adipocytes
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSAAEAGGVFHRARGRTLAAFPAEKESEWKGPFYFILGADPQFGLIKAWSTGDCDNGGDEWEQEIRLTEQ      1 - 70
AVQAINKLNPKPKFFVLCGDLIHAMPGKPWRTEQTEDLKRVLRAVDRAIPLVLVSGNHDIGNTPTAETVE     71 - 140
EFCRTWGDDYFSFWVGGVLFLVLNSQFYENPSKCPSLKQAQDQWLDEQLSIARQRHCQHAIVFQHIPLFL    141 - 210
ESIDEDDDYYFNLSKSTRKKLADKFIHAGVKVVFSGHYHRNAGGTYQNLDMVVSSAIGCQLGRDPHGLRV    211 - 280
VVVTAEKIVHRYYSLDELSEKGIEDDLMDLIKKK                                        281 - 314
//

Text Mined References (16)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23939394 2013 Downregulation of CPPED1 expression improves glucose metabolism in vitro in adipocytes.
23799035 2013 CSTP1, a novel protein phosphatase, blocks cell cycle, promotes cell apoptosis, and suppresses tumor growth of bladder cancer by directly dephosphorylating Akt at Ser473 site.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15991289 2005 Transactivating effect of complete S protein of hepatitis B virus and cloning of genes transactivated by complete S protein using suppression subtractive hybridization technique.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.