Property Summary

NCBI Gene PubMed Count 42
PubMed Score 108.09
PubTator Score 118.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
hepatocellular carcinoma 1.100 2.1e-05
osteosarcoma -2.707 3.2e-07
non-small cell lung cancer 1.209 3.7e-23
intraductal papillary-mucinous neoplasm ... 1.400 1.3e-02
lung cancer 1.100 1.5e-03
group 4 medulloblastoma -1.100 2.5e-02
subependymal giant cell astrocytoma -1.868 9.0e-03

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (17)

PMID Text
24078084 The monomer form of mutated CPOX did not show any activity and homodimeric enzymes derived from Hereditary coproporphyria (HCP) mutant showed low activity (<20% of the control).
22765978 Polymorphism of coproporphyrinogen oxidase is associated with genetic susceptibility to the adverse neurobehavioral effects of Hg exposure in children.
22288185 CPOX polymorphisms are associated with biological media contamination and apoptosis disorders.
21277781 competitive action of both uroporphyrinogen decarboxylase and CPO on the same diacetate porphyrinogen substrate provides additional perspectives on the potential existence of abnormal pathways for heme biosynthesis
21231929 Deletion of the fifth exon in the CPOX gene is associated with hereditary coproporphyria.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19339664 biochemical & kinetic properties of CPOX4, the product of a polymorphism of the CPOX gene that modifies effects of mercury on neurobehavioral function; suggests CPOX4 may predispose to impaired heme biosynthesis which is limited further by Hg exposure
19267996 Three of the novel missense mutations and one frameshift mutation was detected in coproporphyrinogen III oxidase (CPO) gene in five Italian patients affected by Hereditary Coproporphyria (HCP).
18557518 The authors report the association of a novel mutation in the coproporphyrinogen oxidase gene in an Irish pedigree with the devlopment of hereditary coproporphyria
17179900 His158 of human CPO may have a role in the active site, but none of the conserved histidine residues of human coproporphyrinogen oxidase is essential for catalytic activity.
16343843 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16258391 The Km recognition) and Kcat values for coproporphyrinogen III and IV were determined.
16176984 CPO mutations form the structural basis of hereditary coproporphyria.
16159891 All other type of mutations or missense mutations mapped elsewhere throughout the CPO gene, lead to coproporphyrin accumulation and subsequently typical HCP.
14669009 Modulation of penetrance by the wild-type allele in dominantly inherited erythrohepatic and acute hepatic porphyrias was studied using CPO.
12208494 coproporphyrinogen III oxidase sequence matches many structural features from urate oxidase
12181641 disease-producing mutations in the CPO gene in nine Swedish families with hereditary coproporphyria

AA Sequence

MALQLGRLSSGPCWLVARGGCGGPRAWSQCGGGGLRAWSQRSAAGRVCRPPGPAGTEQSRGLGHGSTSRG      1 - 70
GPWVGTGLAAALAGLVGLATAAFGHVQRAEMLPKTSGTRATSLGRPEEEEDELAHRCSSFMAPPVTDLGE     71 - 140
LRRRPGDMKTKMELLILETQAQVCQALAQVDGGANFSVDRWERKEGGGGISCVLQDGCVFEKAGVSISVV    141 - 210
HGNLSEEAAKQMRSRGKVLKTKDGKLPFCAMGVSSVIHPKNPHAPTIHFNYRYFEVEEADGNKQWWFGGG    211 - 280
CDLTPTYLNQEDAVHFHRTLKEACDQHGPDLYPKFKKWCDDYFFIAHRGERRGIGGIFFDDLDSPSKEEV    281 - 350
FRFVQSCARAVVPSYIPLVKKHCDDSFTPQEKLWQQLRRGRYVEFNLLYDRGTKFGLFTPGSRIESILMS    351 - 420
LPLTARWEYMHSPSENSKEAEILEVLRHPRDWVR                                        421 - 454
//

Text Mined References (47)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24078084 2013 The enzyme engineering of mutant homodimer and heterodimer of coproporphyinogen oxidase contributes to new insight into hereditary coproporphyria and harderoporphyria.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22765978 Modification of neurobehavioral effects of mercury by a genetic polymorphism of coproporphyrinogen oxidase in children.
22288185 2011 [Polymorphism of TNF gene and CPOX gene in chemical industry workers].
21277781 2011 Normal and abnormal heme biosynthesis. Part 7. Synthesis and metabolism of coproporphyrinogen-III analogues with acetate or butyrate side chains on rings C and D. Development of a modified model for the active site of coproporphyrinogen oxidase.
21269460 2011 Initial characterization of the human central proteome.
21231929 2012 Identification of an AluY-mediated deletion of exon 5 in the CPOX gene by MLPA analysis in patients with hereditary coproporphyria.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19339664 2009 Cloning, expression, and biochemical properties of CPOX4, a genetic variant of coproporphyrinogen oxidase that affects susceptibility to mercury toxicity in humans.
19267996 2009 Four novel mutations of the coproporphyrinogen III oxidase gene.
18557518 2008 Hereditary coproporphyria: report of an Irish kindred and identification of a novel gene mutation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17179900 2007 Investigation of the catalytic and structural roles of conserved histidines of human coproporphyrinogen oxidase using site-directed mutagenesis.
16398658 2006 Dual gene defects involving delta-aminolaevulinate dehydratase and coproporphyrinogen oxidase in a porphyria patient.
16343843 The association between a genetic polymorphism of coproporphyrinogen oxidase, dental mercury exposure and neurobehavioral response in humans.
16258391 2005 Kinetic evaluation of human cloned coproporphyrinogen oxidase using a ring isomer of the natural substrate.
16176984 2005 Structural basis of hereditary coproporphyria.
16159891 2005 Mutations in human CPO gene predict clinical expression of either hepatic hereditary coproporphyria or erythropoietic harderoporphyria.
15896662 2005 Biochemical and genetic characterization of four cases of hereditary coproporphyria in Spain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14669009 2004 Modulation of penetrance by the wild-type allele in dominantly inherited erythropoietic protoporphyria and acute hepatic porphyrias.
12862310 2003 The long, but not the short, presequence of human coproporphyrinogen oxidase is essential for its import and sorting to mitochondria.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12227458 2002 A molecular, enzymatic and clinical study in a family with hereditary coproporphyria.
12208494 2002 Towards a new T-fold protein?: the coproporphyrinogen III oxidase sequence matches many structural features from urate oxidase.
12181641 2002 Two novel mutations and coexistence of the 991C>T and the 1339C>T mutation on a single allele in the coproporphyrinogen oxidase gene in Swedish patients with hereditary coproporphyria.
12059041 2002 Mutant and wild-type alpha-synuclein interact with mitochondrial cytochrome C oxidase.
11309681 2001 Characterization of mutations in the CPO gene in British patients demonstrates absence of genotype-phenotype correlation and identifies relationship between hereditary coproporphyria and harderoporphyria.
11248690 2001 Expression of coproporphyrinogen oxidase and synthesis of hemoglobin in human erythroleukemia K562 cells.
9888388 1999 Systematic analysis of coproporphyrinogen oxidase gene defects in hereditary coproporphyria and mutation update.
9843038 1998 Identification of a novel mutation of the CPO gene in a Japanese hereditary coproporphyria family.
9454777 1998 Neonatal hemolytic anemia due to inherited harderoporphyria: clinical characteristics and molecular basis.
9298818 1997 Hereditary coproporphyria: exon screening by heteroduplex analysis detects three novel mutations in the coproporphyrinogen oxidase gene.
9048920 1997 A novel missense mutation in exon 4 of the human coproporphyrinogen oxidase gene in two patients with hereditary coproporphyria.
8990017 1997 Three novel mutations in the coproporphyrinogen oxidase gene.
8407975 1993 Coproporphyrinogen oxidase. Purification, molecular cloning, and induction of mRNA during erythroid differentiation.
8286403 1994 Molecular cloning, sequencing and expression of cDNA encoding human coproporphyrinogen oxidase.
8159699 1994 Molecular cloning, sequencing, and functional expression of a cDNA encoding human coproporphyrinogen oxidase.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8012360 1994 Homozygous hereditary coproporphyria caused by an arginine to tryptophane substitution in coproporphyrinogen oxidase and common intragenic polymorphisms.
7987309 1994 Coproporphyrinogen oxidase: gene organization and description of a mutation leading to exon 6 skipping.
7959694 1994 Localization of the human coproporphyrinogen oxidase gene to chromosome band 3q12.
7849704 1994 Characterization and expression of cDNA encoding coproporphyrinogen oxidase from a patient with hereditary coproporphyria.
7757079 1995 A molecular defect in coproporphyrinogen oxidase gene causing harderoporphyria, a variant form of hereditary coproporphyria.