Property Summary

Ligand Count 11
NCBI Gene PubMed Count 24
PubMed Score 529.15
PubTator Score 110.98

Knowledge Summary


No data available


  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.713 9.6e-04

Gene RIF (9)

AA Sequence

QVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQRGPA                                    421 - 458

Text Mined References (26)

PMID Year Title