Property Summary

NCBI Gene PubMed Count 19
PubMed Score 4.04
PubTator Score 8.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
malignant mesothelioma -1.700 5.6e-06
osteosarcoma 1.373 1.8e-02
glioblastoma 1.200 2.3e-03
cystic fibrosis 2.883 4.6e-07
Atopic dermatitis -1.900 6.8e-04
pancreatic ductal adenocarcinoma liver m... -1.513 6.1e-03
tuberculosis 2.500 6.4e-06
non-small cell lung cancer -2.054 5.5e-20
intraductal papillary-mucinous adenoma (... -1.400 7.9e-03
intraductal papillary-mucinous carcinoma... -2.800 2.8e-03
intraductal papillary-mucinous neoplasm ... -2.700 2.1e-03
colon cancer -1.400 1.4e-02
fibroadenoma -1.400 3.1e-02
lung adenocarcinoma -1.800 6.8e-18
adult high grade glioma 1.600 1.2e-04
pilocytic astrocytoma 2.200 1.4e-07
sonic hedgehog group medulloblastoma 1.200 4.8e-03
lung carcinoma -2.400 9.0e-24
breast carcinoma -1.400 3.9e-17
ductal carcinoma in situ -2.500 7.3e-05
invasive ductal carcinoma -2.900 6.6e-04
acute myeloid leukemia -1.300 1.2e-02
ovarian cancer -2.500 4.2e-10
pituitary cancer -1.100 1.3e-03
pancreatic cancer 1.600 3.1e-03
head and neck cancer -1.700 3.0e-02

Gene RIF (3)

PMID Text
24945404 Variants at the CPED1 locus were strongly associated with bone mineral density at the skull and upper limb sites, but not with lower limb-bone mineral density.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20031566 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MVCRPVFPCRRRFCPRPFLVGLVVAICLFYQTLTLRGSRKLTAAAPGAVPHTSTETQASRCKKGFSQDKQ      1 - 70
CFLLSGNAQETRKVKESMETHFGSHGRRAILYRPPFYSKTELQLHQHILTQHGYTVVIAEERLNAGLGPG     71 - 140
LLEQGDLGSWDLLICLSSKKAEGTPCISKEVMCQLGLHQKANRLPEIQQPLCRKEGLCQIVRRFPELQLP    141 - 210
VSPSVCLDQGMQLKPSTSSHLLKTVKPRVWKPGDWSREQLNETTVLAPHETIFRAEDLSVILKAYVLVTS    211 - 280
LTPLRAFIHSTGTVWNPPKKKRFTVKLQTFFETFLRASSPQQAFDIMKEAIGKLLLAAEVFSETSTLGPK    281 - 350
TFHRCRFCFQLLTFDIGYGSFMYPVVLQVHEHLNFQDYDNMDFEDQNTEEFLLNDTFNFLFPNESSLSIF    351 - 420
SEIFQRLYRSDVFKGENYQKELNQCLSLEEINSIMTFIKELGSLGQFQLLFPSTTPGIQSLMHEFYDVAN    421 - 490
PVGNPGSVLTQYWSLLNVFEQFQFMNKKTQPHPLEWNSFTEDKNIEKPQVPFDAIENKKAAVPQIKNENK    491 - 560
EIHCSDDENTPCHIKQIFTHPHLELNPDFHPKIKDYYCEVPFDVVTVTIGVETPKCLCKVHLYEQAGPSF    561 - 630
ASYPLGLGMNKISIFVVDESPAHGETLITYKLTIYREDRPSLPLFEAFTACGFVQDCGLLIHPEETCGLQ    631 - 700
PISSDYIEAILQSELKRCPSGDMKGQWIVPCLSCSDNRTCDWREITWQPHNCQYGVLTKPQLQQCLGGRK    701 - 770
ILFIGDSTNRGIMYYLIERLNETLQEWQKVHGTKFYHNVNGGKTLISYSYYPQFWISPSLRPTFENALEH    771 - 840
LLQRSRPLENTGQTVLVVGGVQWLNSNHLQIIHKVLKRENLLNILVIIKTLGIGFHLPVDGVHFLTQSEV    841 - 910
QNLWKENLIILDTAKKHGYEVVDTFTITMGRYKEFLQGKCGCHFHEVVKSKLSKEYNFIKMKRSRNHIMG    911 - 980
RYFSNQSKLQQGTVTNFRSPYHVRGPINQVCSEILLSRMCANKRTM                            981 - 1026
//

Text Mined References (22)

PMID Year Title
24945404 2014 Phenotypic dissection of bone mineral density reveals skeletal site specificity and facilitates the identification of novel loci in the genetic regulation of bone mass attainment.
22792070 2012 Meta-analysis of genome-wide scans for total body BMD in children and adults reveals allelic heterogeneity and age-specific effects at the WNT16 locus.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20082467 2010 A complex chromosome 7q rearrangement identified in a patient with mental retardation, anxiety disorder, and autistic features.
20056006 2010 Novel eukaryotic enzymes modifying cell-surface biopolymers.
20031566 2009 Association of regions on chromosomes 6 and 7 with blood pressure in Nigerian families.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.