Property Summary

NCBI Gene PubMed Count 57
PubMed Score 983.11
PubTator Score 223.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
oligodendroglioma 1.500 1.7e-03
psoriasis -1.300 3.0e-05
osteosarcoma 3.629 5.9e-04
cystic fibrosis 1.452 4.0e-04
glioblastoma -1.900 5.9e-04
type II diabetes mellitus and post-ische... 1.100 3.5e-02
atypical teratoid / rhabdoid tumor -2.700 1.5e-04
medulloblastoma, large-cell -1.800 2.7e-05
primitive neuroectodermal tumor -1.600 5.6e-04
Duchenne muscular dystrophy 1.027 2.1e-03
autosomal dominant Emery-Dreifuss muscul... 1.426 2.2e-02
fascioscapulohumeral muscular dystrophy 1.110 3.5e-03
juvenile dermatomyositis 1.273 1.1e-07
Atopic dermatitis -1.700 4.5e-04
adrenocortical carcinoma -1.772 6.2e-04
intraductal papillary-mucinous adenoma (... -2.100 2.0e-03
intraductal papillary-mucinous neoplasm ... -3.000 1.1e-03
lung cancer 1.700 1.6e-04
interstitial cystitis -1.400 8.6e-03
pediatric high grade glioma -1.400 5.0e-04
invasive ductal carcinoma -1.318 1.9e-03
lung carcinoma 3.700 9.5e-34
breast carcinoma -1.600 3.5e-31
Breast cancer -2.000 5.4e-05
ovarian cancer -4.500 3.0e-15
Down syndrome 1.100 3.6e-03

Gene RIF (31)

PMID Text
26228366 Down-expression of liver carboxypeptidase E may reduce the secretion of serum cholecystokinin and contribute to the formation of cholesterol gallstone.
25374060 Downregulation of CPE regulates cell proliferation and chemosensitivity in pancreatic cancer.
24843127 Disruption of insulin receptor (IR) expression in beta cells has a direct impact on the expression of the convertase enzyme carboxypeptidase E (CPE) by inhibition of the eukaryotic translation initiation factor Eif4g1.
24006921 Upregulation of CPE promotes cell proliferation and tumorigenicity in colorectal cancer.
23852859 Data suggest that splice variant of carboxypeptidase E (CPE-DeltaN) that CPE-DeltaN expression might be a potential prognostic marker for colorectal cancer patients.
22998035 CPE is essential in the process and targeting of neuropeptides and neurotrophins, its participation in the pathological progression of Alzheimer's disease may be suggested
22824791 CPE forms a complex, probably through sequences located at its N-terminal domain, with Wnt3a and the extracellular cysteine rich domain of Fz1.
21628999 Neither high glucose nor insulin (with low glucose) regulates beta-cell CPE (but either up-regulates CPD).
21285511 an N-terminal truncated carboxypeptidase E splice isoform induces tumor growth and is a biomarker for predicting future metastasis in human cancers
21061162 CPE may play a role in promoting tumor growth and invasion.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201924 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19593212 Observational study of gene-disease association. (HuGE Navigator)
19491387 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19166515 Carboxypeptidase E may be a key molecule to regulate Caspr2 (carboxypeptidase E) trafficking to the cell membrane.
19120309 CPH-Abs may allow discrimination of a more latent subset of adult-onset autoimmune diabetes (LADA).
19077438 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18550819 Carboxypeptidase E degradation contributes to palmitate-induced beta-cell ER stress and apoptosis; CPE is a major link between hyperlipidemia and beta-cell death pathways in diabetes.
18501121 polymorphism in the CPE exon5 gene may contribute to the angiographical characteristics of coronary atherosclerosis in the Chinese population
18501121 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18080843 the severity of the coronary atherosclerosis estimated by Gensini score was significantly influenced by the presence of the A2925G mutant and G2855A mutant of the CPE gene
18080843 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17957445 A possible role for mutations in CPE in the development of coronary heart disease.
17957445 Observational study of gene-disease association. (HuGE Navigator)
15492986 cDNA microarray analysis led to the identification of 2 novel biomarkers that should facilitate molecular diagnosis and further study of pulmonary neuroendocrine tumors.
14690244 protein binding with Con A in seminal plasma
12530526 Carboxypeptidase E is differently expressed in subcutaneous and visceral fat of obese subjects
11462236 missense polymorphism encoding altered activity

AA Sequence

MAGRGGSALLALCGALAACGWLLGAEAQEPGAPAAGMRRRRRLQQEDGISFEYHRYPELREALVSVWLQC      1 - 70
TAISRIYTVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQKGNE     71 - 140
TIVNLIHSTRIHIMPSLNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVYVNEKEGGPNNH    141 - 210
LLKNMKKIVDQNTKLAPETKAVIHWIMDIPFVLSANLHGGDLVANYPYDETRSGSAHEYSSSPDDAIFQS    211 - 280
LARAYSSFNPAMSDPNRPPCRKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPP    281 - 350
EETLKTYWEDNKNSLISYLEQIHRGVKGFVRDLQGNPIANATISVEGIDHDVTSAKDGDYWRLLIPGNYK    351 - 420
LTASAPGYLAITKKVAVPYSPAAGVDFELESFSERKEEEKEELMEWWKMMSETLNF                  421 - 476
//

Text Mined References (58)

PMID Year Title
26228366 The expression of hepatic carboxypeptidase E is decreased in patients with cholesterol gallstone.
25374060 2014 Downregulation of CPE regulates cell proliferation and chemosensitivity in pancreatic cancer.
24843127 2014 Insulin regulates carboxypeptidase E by modulating translation initiation scaffolding protein eIF4G1 in pancreatic ? cells.
24470285 2014 Carboxypeptidases in disease: insights from peptidomic studies.
24006921 2013 Upregulation of CPE promotes cell proliferation and tumorigenicity in colorectal cancer.
23852859 2013 Overexpression of CPE-?N predicts poor prognosis in colorectal cancer patients.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22998035 2013 Secretory sorting receptors carboxypeptidase E and secretogranin III in amyloid ?-associated neural degeneration in Alzheimer's disease.
22824791 2013 Carboxypeptidase E: a negative regulator of the canonical Wnt signaling pathway.
21628999 Differential regulation and localization of carboxypeptidase D and carboxypeptidase E in human and mouse ?-cells.
21285511 2011 An N-terminal truncated carboxypeptidase E splice isoform induces tumor growth and is a biomarker for predicting future metastasis in human cancers.
21061162 2010 Carboxypeptidase E: elevated expression correlated with tumor growth and metastasis in pheochromocytomas and other cancers.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201924 2010 Genome-wide association study of alcohol dependence implicates a region on chromosome 11.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19593212 2009 Novel genetic variants contributing to left ventricular hypertrophy: the HyperGEN study.
19491387 2009 Severe obesity is associated with novel single nucleotide polymorphisms of the ESR1 and PPARgamma locus in Han Chinese.
19166515 2009 Contactin-associated protein (Caspr) 2 interacts with carboxypeptidase E in the CNS.
19120309 2008 Carboxypeptidase-H autoantibodies differentiate a more latent subset of autoimmune diabetes from phenotypic type 2 diabetes among Chinese adults.
19077438 2009 Analysis of 30 genes (355 SNPS) related to energy homeostasis for association with adiposity in European-American and Yup'ik Eskimo populations.
18550819 2008 Carboxypeptidase E mediates palmitate-induced beta-cell ER stress and apoptosis.
18501121 2008 Association of human carboxypeptidase E exon5 gene polymorphisms with angiographical characteristics of coronary atherosclerosis in a Chinese population.
18080843 2009 Association of the mutation for the human carboxypeptidase E gene exon 4 with the severity of coronary artery atherosclerosis.
17957445 2008 Molecular scanning of the human carboxypeptidase E gene for mutations in Chinese subjects with coronary atherosclerosis.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15664176 2005 Sorting and activity-dependent secretion of BDNF require interaction of a specific motif with the sorting receptor carboxypeptidase e.
15492986 2004 Identification of carboxypeptidase E and gamma-glutamyl hydrolase as biomarkers for pulmonary neuroendocrine tumors by cDNA microarray.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14690244 2003 Identification of gp17 glycoprotein and characterization of prostatic acid phosphatase (PAP) and carboxypeptidase E (CPE) fragments in a human seminal plasma fraction interacting with concanavalin A.
12530526 2002 Carboxypeptidase E and thrombospondin-1 are differently expressed in subcutaneous and visceral fat of obese subjects.
12479974 2003 Biosynthesis and processing of pro CCK: recent progress and future challenges.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417617 2002 Immunohistochemical localization of carboxypeptidases D, E, and Z in pituitary adenomas and normal human pituitary.
12270926 2002 Deficiencies in pro-thyrotropin-releasing hormone processing and abnormalities in thermoregulation in Cpefat/fat mice.
11462236 2001 Missense polymorphism in the human carboxypeptidase E gene alters enzymatic activity.
11375130 2001 Attenuated processing of proglucagon and glucagon-like peptide-1 in carboxypeptidase E-deficient mice.
11373325 2001 Immunohistochemical localization and comparison of carboxypeptidases D, E, and Z, alpha-MSH, ACTH, and MIB-1 between human anterior and corticotroph cell "basophil invasion" of the posterior pituitary.
10966857 2000 Translational regulation of proinsulin biosynthesis and proinsulin conversion in the pancreatic beta-cell.
9815277 1998 Immunohistochemical localization of carboxypeptidases E and D in the human placenta and umbilical cord.
9662053 1998 Organization of the human carboxypeptidase E gene and molecular scanning for mutations in Japanese subjects with NIDDM or obesity.
9369230 1997 Disturbed progastrin processing in carboxypeptidase E-deficient fat mice.
9275097 1997 Cholecystokinin (CCK) levels are greatly reduced in the brains but not the duodenums of Cpe(fat)/Cpe(fat) mice: a regional difference in the involvement of carboxypeptidase E (Cpe) in pro-CCK processing.
9197538 1997 Analysis of an expression profile of genes in the human adipose tissue.
9019408 1997 Carboxypeptidase E is a regulated secretory pathway sorting receptor: genetic obliteration leads to endocrine disorders in Cpe(fat) mice.
8864828 1996 Cloning of candidate autoantigen carboxypeptidase H from a human islet library: sequence identity with human brain CPH.
8770919 1996 Impaired processing of brain proneurotensin and promelanin-concentrating hormone in obese fat/fat mice.
8674818 1995 The post-translational processing and intracellular sorting of carboxypeptidase H in the islets of Langerhans.
8449522 1993 Assignment of the human carboxypeptidase E (CPE) gene to chromosome 4.
7790890 1995 Processing of procarboxypeptidase E into carboxypeptidase E occurs in secretory vesicles.
7663508 1995 Hyperproinsulinaemia in obese fat/fat mice associated with a carboxypeptidase E mutation which reduces enzyme activity.
7477119 1995 Brief report: impaired processing of prohormones associated with abnormalities of glucose homeostasis and adrenal function.
6808517 1982 Enkephalin convertase: purification and characterization of a specific enkephalin-synthesizing carboxypeptidase localized to adrenal chromaffin granules.
2334405 1990 Human carboxypeptidase E. Isolation and characterization of the cDNA, sequence conservation, expression and processing in vitro.