Property Summary

NCBI Gene PubMed Count 21
PubMed Score 52.16
PubTator Score 30.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (9)

PMID Text
26316592 This study showed that CPA2 and CPB1 variants are not associated with chronic pancreatitis.
26115097 CPMG RD data analysis thus allowed a detailed structural characterization of the ADA2h denatured state under folding conditions not previously achieved for this protein.
21098023 Chymotrypsin C is a co-activator of human pancreatic procarboxypeptidases A1 and A2.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19817500 we have used one of the best-characterized models for folding and misfolding, the activation domain of procarboxypeptidase A2. The wild type (WT) and three mutants affecting the kinetics of aggregation have been studied by IR from the folded state
19401682 Observational study of gene-disease association. (HuGE Navigator)
17196978 The high-resolution crystal structure and solution NMR structure of AYEdesign show that the experimentally determined backbone and side-chains conformations are effectively superimposable with the computational model at atomic resolution.
12538893 NMR structure of the activation domain
11743734 changes in zinc ligation promote remodeling of the active site in the zinc hydrolase superfamily

AA Sequence

MAMRLILFFGALFGHIYCLETFVGDQVLEIVPSNEEQIKNLLQLEAQEHLQLDFWKSPTTPGETAHVRVP      1 - 70
FVNVQAVKVFLESQGIAYSIMIEDVQVLLDKENEEMLFNRRRERSGNFNFGAYHTLEEISQEMDNLVAEH     71 - 140
PGLVSKVNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIVSDYGKDPSITSIL    141 - 210
DALDIFLLPVTNPDGYVFSQTKNRMWRKTRSKVSGSLCVGVDPNRNWDAGFGGPGASSNPCSDSYHGPSA    211 - 280
NSEVEVKSIVDFIKSHGKVKAFITLHSYSQLLMFPYGYKCTKLDDFDELSEVAQKAAQSLRSLHGTKYKV    281 - 350
GPICSVIYQASGGSIDWSYDYGIKYSFAFELRDTGRYGFLLPARQILPTAEETWLGLKAIMEHVRDHPY     351 - 419
//

Text Mined References (24)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26316592 2015 Variants in pancreatic carboxypeptidase genes CPA2 and CPB1 are not associated with chronic pancreatitis.
26115097 2015 Probing the Residual Structure of the Low Populated Denatured State of ADA2h under Folding Conditions by Relaxation Dispersion Nuclear Magnetic Resonance Spectroscopy.
21098023 2011 Chymotrypsin C is a co-activator of human pancreatic procarboxypeptidases A1 and A2.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19817500 2009 Influence of aggregation propensity and stability on amyloid fibril formation as studied by Fourier transform infrared spectroscopy and two-dimensional COS analysis.
19401682 2010 High-density SNP association study and copy number variation analysis of the AUTS1 and AUTS5 loci implicate the IMMP2L-DOCK4 gene region in autism susceptibility.
17196978 2007 High-resolution structural and thermodynamic analysis of extreme stabilization of human procarboxypeptidase by computational protein design.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
12948494 2003 A large scale test of computational protein design: folding and stability of nine completely redesigned globular proteins.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12538893 2003 NMR solution structure of the activation domain of human procarboxypeptidase A2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11743734 2001 Changes in zinc ligation promote remodeling of the active site in the zinc hydrolase superfamily.
10860668 2000 Construction of a physical and transcript map flanking the imprinted MEST/PEG1 region at 7q32.
10742178 2000 Structure of a novel leech carboxypeptidase inhibitor determined free in solution and in complex with human carboxypeptidase A2.
9450539 1997 Characterisation and preliminary X-ray diffraction analysis of human pancreatic procarboxypeptidase A2.
9384570 1997 The three-dimensional structure of human procarboxypeptidase A2. Deciphering the basis of the inhibition, activation and intrinsic activity of the zymogen.
8806703 1996 Expression and characterization of human pancreatic preprocarboxypeptidase A1 and preprocarboxypeptidase A2.
8318831 Separation of human pancreatic carboxypeptidase A isoenzymes by high performance liquid chromatography.
7896805 1995 The sequence and conformation of human pancreatic procarboxypeptidase A2. cDNA cloning, sequence analysis, and three-dimensional model.
2920728 1989 Purification and properties of five different forms of human procarboxypeptidases.