Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.18
PubTator Score 9.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
astrocytic glioma 2241 5.0e-02
Disease Target Count Z-score Confidence
Leigh disease 81 3.434 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
astrocytic glioma -1.300 5.0e-02

Synonym

Accession O14548 Q9P118
Symbols EB1
SIG81
COX7AR
COX7RP

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20307258 Novel insights into the assembly and function of human nuclear-encoded cytochrome c oxidase subunits 7a
19834535 Observational study of gene-disease association. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKA      1 - 70
DGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK                               71 - 114
//

Text Mined References (15)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20307258 2010 Novel insights into the assembly and function of human nuclear-encoded cytochrome c oxidase subunits 4, 5a, 6a, 7a and 7b.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14562965 2003 Retention of a duplicate gene through changes in subcellular targeting: an electron transport protein homologue localizes to the golgi.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11156535 2001 A genomewide linkage-disequilibrium scan localizes the Saguenay-Lac-Saint-Jean cytochrome oxidase deficiency to 2p16.
10335655 1999 Molecular evolution of the COX7A gene family in primates.
9418891 1998 Isolation of estrogen-responsive genes with a CpG island library.
8647836 1996 Identification of an additional member of the cytochrome c oxidase subunit VIIa family of proteins.