Property Summary

NCBI Gene PubMed Count 45
PubMed Score 203.34
PubTator Score 76.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 3.4e-08
glioblastoma -1.200 1.5e-03
medulloblastoma, large-cell -1.500 5.2e-05
osteosarcoma 1.148 4.0e-05
ovarian cancer -1.100 4.6e-05
psoriasis 1.400 2.3e-04
tuberculosis and treatment for 6 months 1.200 1.2e-04

 GWAS Trait (1)

Gene RIF (18)

AA Sequence

MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASW      1 - 70
SSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAK     71 - 140
QTKRMLDMKVNPIQGLASKWDYEKNEWKK                                             141 - 169
//

Text Mined References (50)

PMID Year Title