Property Summary

NCBI Gene PubMed Count 40
PubMed Score 190.95
PubTator Score 76.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Leprosy 77
Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 3.42092534744441E-8
osteosarcoma 7933 3.95525922400131E-5
ovarian cancer 8492 4.58523254602789E-5
medulloblastoma, large-cell 6234 5.19315253621734E-5
psoriasis 6685 7.26632920894822E-5
tuberculosis and treatment for 6 months 686 1.20343297493964E-4
glioblastoma 5572 0.00148330744667498
Disease Target Count Z-score Confidence
Obesity 616 3.119 1.6

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis 1.800 0.000
osteosarcoma 1.148 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.200 0.001
medulloblastoma, large-cell -1.500 0.000
tuberculosis and treatment for 6 months 1.200 0.000
ovarian cancer -1.100 0.000

Synonym

Accession P13073 B2R4J2 D3DUM7 Q6P666
Symbols COX4
COXIV
COX4-1
COXIV-1
COX IV-1

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (16)

PMID Text
25726526 We provide evidence that COX4-1 controls BMI1 expression via a redox mechanism
23285255 COXIV mRNA (1.6 fold; P<0.01) and COXIV protein expression (1.5 fold; P<0.05) were increased by training but COXIV protein expression was decreased (20%; P<0.01) by acute exercise pre- and post-training.
22419111 Tat-induced mitochondrial membrane permeabilization is associated with inhibition of cytochrome c oxidase (COX) activity by Tat in disrupted mitochondria from human samples
22190034 Tat-induced mitochondrial membrane permeabilization is associated with inhibition of cytochrome c oxidase (COX) activity by Tat in disrupted mitochondria from human samples
22079200 Studies indicate that the cytochrome oxidase enzyme-substrate (ES) Michaelis complex of cell respiration, the dioxygen adduct of heme a(3), which he termed Compound A.
21978537 Studies indicate that the mechanism for proton pumping in cytochrome c oxidase is based on an electrostatic analysis of a kinetic experiment for the O to E transition.
21939634 Studies indicate that nitric oxide (NO) inhibition of cytochrome c oxidase (CcOX) is rapid and reversible and may occur in competition with oxygen.
21841246 COX activity (electron transport complex IV) is reduced by 29% in maternal history of Alzheimer's disease compared to normal controls, and by 30% compared to paternal history of Alzheimer's disease.
21802404 Studies suggest that the main function of nuclear encoded subunits of cytochrome c oxidase appears to be "only" to control the activity of the mitochondrial subunits.
21771582 Studies suggest a model that links cell signaling with the phosphorylation state of Cytochrome c (Cytc) and cytochrome c oxidase (COX).
More...

AA Sequence

MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASW      1 - 70
SSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAK     71 - 140
QTKRMLDMKVNPIQGLASKWDYEKNEWKK                                             141 - 169
//

Text Mined References (45)

PMID Year Title
26321642 2015 MITRAC7 Acts as a COX1-Specific Chaperone and Reveals a Checkpoint during Cytochrome c Oxidase Assembly.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25726526 2015 Nuclear-encoded cytochrome c oxidase subunit 4 regulates BMI1 expression and determines proliferative capacity of high-grade gliomas.
25642632 2015 Discovery of six new susceptibility loci and analysis of pleiotropic effects in leprosy.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23285255 2012 Short-term intensified cycle training alters acute and chronic responses of PGC1? and Cytochrome C oxidase IV to exercise in human skeletal muscle.
23260140 2012 MITRAC links mitochondrial protein translocation to respiratory-chain assembly and translational regulation.
More...