Property Summary

NCBI Gene PubMed Count 14
PubMed Score 24.44
PubTator Score 9.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.100 2.3e-02
astrocytic glioma -1.400 2.3e-02
atypical teratoid / rhabdoid tumor -1.400 3.2e-06
ependymoma -1.500 3.3e-02
glioblastoma -1.300 1.3e-05
lung cancer 1.500 2.7e-03
medulloblastoma -1.400 8.1e-04
medulloblastoma, large-cell -1.500 1.9e-03
Multiple myeloma 1.683 1.1e-03
oligodendroglioma -1.200 4.7e-02
osteosarcoma -1.162 1.6e-03
ovarian cancer -1.600 3.0e-08
pancreatic ductal adenocarcinoma liver m... -1.101 2.6e-02
Parkinson's disease -1.100 9.5e-03
primitive neuroectodermal tumor -1.300 5.3e-04
psoriasis -1.300 4.7e-04

Gene RIF (4)

AA Sequence

MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQP      1 - 70
PRRPKSSNPFTRAQEEERRRQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIE     71 - 140
NMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEAGQ    141 - 210
YFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN        211 - 276
//

Text Mined References (16)

PMID Year Title