Property Summary

NCBI Gene PubMed Count 39
PubMed Score 12.31
PubTator Score 8.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Multiple myeloma 1327 4.7e-04
ovarian cancer 8491 1.4e-03
Disease Target Count Z-score Confidence
osteosarcoma 7933 3.854 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.183 4.7e-04
osteosarcoma -1.005 4.9e-02
ovarian cancer 1.300 1.4e-03

Gene RIF (3)

PMID Text
22237956 this study demonstrates Csn3 as an oncogene that regulates the tumorigenesis process in hepatocellular carcinoma (HCC) cells.
22190034 HIV-1 Vpr is identified to have a physical interaction with COP9 constitutive photomorphogenic homolog subunit 3 (COPS3; CSN3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21436869 of the COPS3 gene might have important roles in metastasis of osteosarcoma cells.

AA Sequence

MASALEQFVNSVRQLSAQGQMTQLCELINKSGELLAKNLSHLDTVLGALDVQEHSLGVLAVLFVKFSMPS      1 - 70
VPDFETLFSQVQLFISTCNGEHIRYATDTFAGLCHQLTNALVERKQPLRGIGILKQAIDKMQMNTNQLTS     71 - 140
IHADLCQLCLLAKCFKPALPYLDVDMMDICKENGAYDAKHFLCYYYYGGMIYTGLKNFERALYFYEQAIT    141 - 210
TPAMAVSHIMLESYKKYILVSLILLGKVQQLPKYTSQIVGRFIKPLSNAYHELAQVYSTNNPSELRNLVN    211 - 280
KHSETFTRDNNMGLVKQCLSSLYKKNIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFAS    281 - 350
INQKDGMVSFHDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPS    351 - 420
SYS                                                                       421 - 423
//

Text Mined References (51)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26456823 2015 CSNAP Is a Stoichiometric Subunit of the COP9 Signalosome.
26427513 2015 Integrated analysis of gene expression and genomic aberration data in osteosarcoma (OS).
24421388 2014 Dynamic regulation of the COP9 signalosome in response to DNA damage.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23695280 2014 Rare copy number variation in cerebral palsy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22631635 2012 Silencing of the COPS3 gene by siRNA reduces proliferation of lung cancer cells most likely via induction of cell cycle arrest and apoptosis.
22292074 2012 Identification of novel candidate oncogenes in chromosome region 17p11.2-p12 in human osteosarcoma.
22237956 2012 Inhibition of Csn3 expression induces growth arrest and apoptosis of hepatocellular carcinoma cells.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21436869 2011 RNAi-mediated COPS3 gene silencing inhibits metastasis of osteogenic sarcoma cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19141280 2009 Symmetrical modularity of the COP9 signalosome complex suggests its multifunctionality.
18850735 2008 Characterization of the human COP9 signalosome complex using affinity purification and mass spectrometry.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17366602 2007 COPS3 amplification and clinical outcome in osteosarcoma.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15861129 2005 Myeloid leukemia factor 1 regulates p53 by suppressing COP1 via COP9 signalosome subunit 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15325100 2004 Amplification and overexpression of genes in 17p11.2 ~ p12 in osteosarcoma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14647295 2003 The COP9 signalosome: an assembly and maintenance platform for cullin ubiquitin ligases?
12917637 2003 Amplification and overexpression of COPS3 in osteosarcomas potentially target TP53 for proteasome-mediated degradation.
12732143 2003 The ubiquitin ligase activity in the DDB2 and CSA complexes is differentially regulated by the COP9 signalosome in response to DNA damage.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12628923 2003 Protein kinase CK2 and protein kinase D are associated with the COP9 signalosome.
12620389 2003 Novel raf kinase protein-protein interactions found by an exhaustive yeast two-hybrid analysis.
12508107 2003 Functional interaction of megalin with the megalinbinding protein (MegBP), a novel tetratrico peptide repeat-containing adaptor molecule.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12220626 2002 Association of the mammalian proto-oncoprotein Int-6 with the three protein complexes eIF3, COP9 signalosome and 26S proteasome.
11997338 2002 Genes in a refined Smith-Magenis syndrome critical deletion interval on chromosome 17p11.2 and the syntenic region of the mouse.
11418127 2001 CSN3 interacts with IKKgamma and inhibits TNF- but not IL-1-induced NF-kappaB activation.
11337588 2001 Promotion of NEDD-CUL1 conjugate cleavage by COP9 signalosome.
11285227 2001 COP9 signalosome-specific phosphorylation targets p53 to degradation by the ubiquitin system.
11114242 2001 The subunit 1 of the COP9 signalosome suppresses gene expression through its N-terminal domain and incorporates into the complex through the PCI domain.
10766246 2000 Integrin LFA-1 interacts with the transcriptional co-activator JAB1 to modulate AP-1 activity.
10191102 1999 Subunit 3 of the COP9 signal transduction complex is conserved from plants to humans and maps within the smith-magenis syndrome critical region in 17p11.2.
9707402 1998 The COP9 complex is conserved between plants and mammals and is related to the 26S proteasome regulatory complex.
9535219 1998 A novel protein complex involved in signal transduction possessing similarities to 26S proteasome subunits.