Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 1.7e-05
Breast cancer 3.000 2.7e-02
diabetes mellitus -1.200 1.0e-03
glioblastoma 1.200 6.8e-06
osteosarcoma -1.003 2.6e-03
ovarian cancer -1.300 1.4e-04
pediatric high grade glioma 1.200 3.0e-07
primitive neuroectodermal tumor 1.100 6.8e-05

AA Sequence

MLLELSEEHKEHLAFLPQVDSAVVAEFGRIAVEFLRRGANPKIYEGAARKLNVSSDTVQHGVEGLTYLLT      1 - 70
ESSKLMISELDFQDSVFVLGFSEELNKLLLQLYLDNRKEIRTILSELAPSLPSYHNLEWRLDVQLASRSL     71 - 140
RQQIKPAVTIKLHLNQNGDHNTKVLQTDPATLLHLVQQLEQALEEMKTNHCRRVVRNIK               141 - 199
//

Text Mined References (14)

PMID Year Title