Property Summary

NCBI Gene PubMed Count 20
PubMed Score 70.00
PubTator Score 6.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Congenital Disorder Of Glycosylation, Type IIH 1 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 2.4e-08
Disease Target Count Z-score Confidence
Congenital disorder of glycosylation 54 3.447 1.7
Disease Target Count Z-score Confidence
Esotropia 31 3.662 1.8
Pain agnosia 104 3.6 1.8
Anisometropia 14 3.281 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.327 2.4e-08

Gene RIF (3)

AA Sequence

MATAATIPSVATATAAALGEVEDEGLLASLFRDRFPEAQWRERPDVGRYLRELSGSGLERLRREPERLAE      1 - 70
ERAQLLQQTRDLAFANYKTFIRGAECTERIHRLFGDVEASLGRLLDRLPSFQQSCRNFVKEAEEISSNRR     71 - 140
MNSLTLNRHTEILEILEIPQLMDTCVRNSYYEEALELAAYVRRLERKYSSIPVIQGIVNEVRQSMQLMLS    141 - 210
QLIQQLRTNIQLPACLRVIGYLRRMDVFTEAELRVKFLQARDAWLRSILTAIPNDDPYFHITKTIEASRV    211 - 280
HLFDIITQYRAIFSDEDPLLPPAMGEHTVNESAIFHGWVLQKVSQFLQVLETDLYRGIGGHLDSLLGQCM    281 - 350
YFGLSFSRVGADFRGQLAPVFQRVAISTFQKAIQETVEKFQEEMNSYMLISAPAILGTSNMPAAVPATQP    351 - 420
GTLQPPMVLLDFPPLACFLNNILVAFNDLRLCCPVALAQDVTGALEDALAKVTKIILAFHRAEEAAFSSG    421 - 490
EQELFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNLGHVNIGAIQEPLAFILPKRE    491 - 560
TLFTLDDQALGPELTAPAPEPPAEEPRLEPAGPACPEGGRAETQAEPPSVGP                      561 - 612
//

Text Mined References (20)

PMID Year Title