Property Summary

NCBI Gene PubMed Count 19
PubMed Score 66.71
PubTator Score 6.43

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
26045774 TMED6-COG8 chimera might act as a novel diagnostic marker in TFE3 translocation renal cell carcinoma.
25179963 Targeted silencing of components of lobe B of the COG complex, namely COG5, COG6, COG7 and COG8, inhibited HIV-1 replication
21805148 wthe origin, evolution and preservation of the COG8/PDF same-strand overlap follow similar mechanistic steps as those documented for antisense overlaps where gain and/or loss of splice sites and polyadenylation signals seems to drive the process.

AA Sequence

MATAATIPSVATATAAALGEVEDEGLLASLFRDRFPEAQWRERPDVGRYLRELSGSGLERLRREPERLAE      1 - 70
ERAQLLQQTRDLAFANYKTFIRGAECTERIHRLFGDVEASLGRLLDRLPSFQQSCRNFVKEAEEISSNRR     71 - 140
MNSLTLNRHTEILEILEIPQLMDTCVRNSYYEEALELAAYVRRLERKYSSIPVIQGIVNEVRQSMQLMLS    141 - 210
QLIQQLRTNIQLPACLRVIGYLRRMDVFTEAELRVKFLQARDAWLRSILTAIPNDDPYFHITKTIEASRV    211 - 280
HLFDIITQYRAIFSDEDPLLPPAMGEHTVNESAIFHGWVLQKVSQFLQVLETDLYRGIGGHLDSLLGQCM    281 - 350
YFGLSFSRVGADFRGQLAPVFQRVAISTFQKAIQETVEKFQEEMNSYMLISAPAILGTSNMPAAVPATQP    351 - 420
GTLQPPMVLLDFPPLACFLNNILVAFNDLRLCCPVALAQDVTGALEDALAKVTKIILAFHRAEEAAFSSG    421 - 490
EQELFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNLGHVNIGAIQEPLAFILPKRE    491 - 560
TLFTLDDQALGPELTAPAPEPPAEEPRLEPAGPACPEGGRAETQAEPPSVGP                      561 - 612
//

Text Mined References (19)

PMID Year Title
26045774 2015 TMED6-COG8 is a novel molecular marker of TFE3 translocation renal cell carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25179963 2014 Target silencing of components of the conserved oligomeric Golgi complex impairs HIV-1 replication.
21805148 2012 Successful COG8 and PDF overlap is mediated by alterations in splicing and polyadenylation signals.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
18353293 2008 Role of the conserved oligomeric Golgi (COG) complex in protein glycosylation.
17331980 2007 COG8 deficiency causes new congenital disorder of glycosylation type IIh.
17220172 2007 A new inborn error of glycosylation due to a Cog8 deficiency reveals a critical role for the Cog1-Cog8 interaction in COG complex formation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15047703 2004 The binary interacting network of the conserved oligomeric Golgi tethering complex.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11980916 2002 Characterization of a mammalian Golgi-localized protein complex, COG, that is required for normal Golgi morphology and function.
11929878 2002 Sec34 is implicated in traffic from the endoplasmic reticulum to the Golgi and exists in a complex with GTC-90 and ldlBp.
11703943 2001 The Sec34/35 Golgi transport complex is related to the exocyst, defining a family of complexes involved in multiple steps of membrane traffic.
11181995 2001 The sequence of the human genome.
11149922 2001 A functional interaction between the survival motor neuron complex and RNA polymerase II.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.