Property Summary

NCBI Gene PubMed Count 15
PubMed Score 58.66
PubTator Score 5.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.200 8.2e-03
osteosarcoma 3.335 1.2e-09
ependymoma -1.400 1.9e-10
glioblastoma -2.100 2.8e-07
atypical teratoid / rhabdoid tumor -1.700 5.7e-09
medulloblastoma -1.300 8.6e-06
medulloblastoma, large-cell -1.700 5.7e-06
primitive neuroectodermal tumor -1.200 2.9e-03
tuberculosis and treatment for 6 months 1.200 9.5e-04
adult high grade glioma -1.900 3.8e-07
pilocytic astrocytoma -1.500 6.0e-08
subependymal giant cell astrocytoma -1.452 1.9e-02
spina bifida -1.823 2.3e-02
ovarian cancer -1.900 4.9e-08
chronic rhinosinusitis -1.381 5.0e-04
cystic fibrosis and chronic rhinosinusit... -1.142 3.7e-03

Gene RIF (2)

PMID Text
19864490 Consortin is a trans-Golgi network cargo receptor for the plasma membrane targeting and recycling of connexins.
18854154 Knockdown of consortin, connexin sorting protein (CNST; C1orf71) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MDDSDTPTYYLQIEPQDGCHPGDSVERSVTCLPSASDENENQLDGDGHEHLTSSDSAMGKPQVSEQDSLN      1 - 70
NNESCTLSCEVAAGENLQNTLCEASRDEQAFLGKDKKIPGKRSPRSKKGTAKKIPPGLFSGDIAPLMQEK     71 - 140
VLSAVTYAVDDEEAAEVNANEQPEAPKLVLQSLFSLIRGEVEQLDSRALPLCLHQIAESYFQEEDYEKAM    141 - 210
KFIQLERLYHEQLLANLSAIQEQWETKWKTVQPHTVTALRNSEKGFNGEDFERLTKICATHQDPLLSKHK    211 - 280
IAAVEKSQERKCSTQLLVSEDPKEGGATTKESESKTCLGTESSKESQHTVEPLGSSPCCHQMDVQTDSPS    281 - 350
LSVTAGKDHMEELLCSAEATLALHTQSSETAGSPSGPDSSEDACEDDSRLQLAQTEACQDVARIEGIAED    351 - 420
PKVFLSSKSKTEPLISPGCDRIPPALISEGKYSQAQRKELRLPLRDASEALPTDQLENNELNELQQPDLT    421 - 490
DSDGKSPQAQADSDGSENVLCGNNQISDLGILLPEVCMAPEEKGDKDDQLNKETEDYLNSLLEGCLKDTE    491 - 560
DSLSYEDNQDDDSDLLQDLSPEEASYSLQENLPSDESCLSLDDLAKRIEIAEVVPTEGLVSILKKRNDTV    561 - 630
GDHPAQMQHKPSKRRVRFQEIDDSLDQDEVGGGSCILLVLLCIATVFLSVGGTALYCTFGDMESPVCTDF    631 - 700
ADNMDFYYTKLLQGVAELKHWIYLS                                                 701 - 725
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22321011 Protein phosphatase 1? interacting proteins in the human brain.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
19946888 2010 Defining the membrane proteome of NK cells.
19864490 2010 Consortin, a trans-Golgi network cargo receptor for the plasma membrane targeting and recycling of connexins.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.