Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.75
PubTator Score 1.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count Z-score Confidence
Kawasaki disease 28 3.115 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.100 3.8e-03
atypical teratoid / rhabdoid tumor -1.100 2.7e-05
ependymoma 1.200 3.3e-12
glioblastoma -1.100 7.1e-05
medulloblastoma, large-cell -1.300 1.1e-03
ovarian cancer -1.700 8.0e-07

Gene RIF (2)

AA Sequence

MGPVRLGILLFLFLAVHEAWAGMLKEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDT      1 - 70
GKRKRHVPYSVSETRLEEALENLCERILDYSVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLE     71 - 140
LWDEPSVEVTYLKKQCETMLEEFEDIVGDWYFHHQEQPLQNFLCEGHVLPAAETACLQETWTGKEITDGE    141 - 210
EKTEGEEEQEEEEEEEEEEGGDKMTKTGSHPKLDREDL                                    211 - 248
//

Text Mined References (7)

PMID Year Title