Property Summary

NCBI Gene PubMed Count 60
PubMed Score 110.42
PubTator Score 411.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.400 2.9e-02
ependymoma -2.200 1.6e-02
psoriasis -1.200 1.8e-04
glioblastoma multiforme -1.400 1.2e-10
oligodendroglioma -1.300 1.3e-07
osteosarcoma -2.006 1.5e-04
sonic hedgehog group medulloblastoma -2.400 1.8e-04
atypical teratoid/rhabdoid tumor -2.100 2.7e-06
medulloblastoma, large-cell -1.500 1.1e-03
lung cancer 1.400 5.1e-04
pediatric high grade glioma -1.600 1.6e-03
subependymal giant cell astrocytoma -3.568 1.3e-03
Pick disease -1.100 7.5e-03
ovarian cancer 1.700 1.0e-05

Protein-protein Interaction (1)

Gene RIF (35)

PMID Text
25930075 This study showed that the expression of CNPase protein was significantly decreased but increase expression mrna in ventral prefrontal white matter in major depressive disorder.
24808540 kidneys express 2',3'-cyclic nucleotide 3'-phosphodiesterase (CNPase), and renal CNPase mediates in part the renal 2',3'-cAMP-adenosine pathway
24260477 2',3'-cyclic nucleotide 3'-phosphodiesterases inhibit hepatitis B virus replication.
23084924 CNP binds to the structural protein Gag and blocks HIV-1 particle assembly after Gag and viral RNA have associated with the plasma membrane.
23084924 CNP targets the MA domain of the HIV-1 Gag protein following its association with the plasma membrane. CNP is packaged into the interior of virions and is resistant to digestion by subtilisin
23032943 Bipolar I disorder and schizophrenia ahare a number of common genetic risk loci and susceptibility genes including the genes coding for 2',3'-cyclic nucleotide 3' phosphodiesterase enzyme.
22954668 No Alzheimer disease-associated differences in CNP and DPYSL2 promoter DNA methylation were observed.
22589395 Differential CNP expression correlated with mouse model survival, and CNP immunoassay of a large GBM tissue microarray also showed significant differential patient survival
22473874 The characteristic features in both humans and mice with their partial CNP 'loss-of-function' genotype are best described as 'catatonia-depression' syndrome.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19508346 verified the molecular interaction of Nogo-A with 2', 3'-cyclic nucleotide 3'-phosphodiesterase (CNP), which could act as a conformational stabilizer for the intrinsically unstructured large segment of Amino-Nogo
19348671 The results suggest that the CNP gene may not be involved in the etiology and pathology of schizophrenia in the Chinese population
19348671 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia
19034380 This protein has been found differentially expressed in the temporal lobe from patients with schizophrenia.
18676363 Almost all multiple sclerosis patients had cerebrospinal fluid IgG directed to isoforms of one of the oligodendroglial molecules, transketolase, 2',3'-cyclic-nucleotide 3'-phosphodiesterase type I, collapsin response mediator protein 2, and tubulin beta4.
18496213 This finding provides support for potential association of the CNP gene but not the MAG gene in schizophrenia in a Caucasian population.
18496213 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18289148 The effect of rs2070106 genotype on the CNP expression was transcript specific, and that the genotype was not associated with the expression of other oligodendrocyte-related genes.
18289148 Observational study of gene-disease association. (HuGE Navigator)
17964117 MOBP and CNP protein in the white matter was not altered.
17306456 Observational study of gene-disease association. (HuGE Navigator)
17306456 study did not find an association between genetic variations in the CNP gene and schizophrenia in the Han Chinese population
17150526 The crystal structure of the catalytic fragment of human CNP (hCNP-CF) at 1.3 A resolution, is determined.
17010574 Observational study of gene-disease association. (HuGE Navigator)
16891421 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16389193 Observational study of gene-disease association. (HuGE Navigator)
16389193 reduced CNP expression in the schizophrenic brain is relevant to disease etiology and therefore provide support for the general hypothesis that altered oligodendrocyte function is an etiological factor in schizophrenia.
16343930 The larger CNP isoform, CNP2, contains an N-terminal mitochondrial targeting signal and is localized either in the cytoplasm or mitochondria. Mitochondrial localization is regulated by phosphorylation of the targeting signal by PKC.
16103231 CNP interacts with tubulin and promotes microtubule assembly for process outgrowth in oligodendrocytes.
15713463 crystal structure of the catalytic fragment
15502338 crystal structure of 2',3'-cyclic nucleotide 3'-phosphohydrolase
12452325 Observational study of gene-disease association. (HuGE Navigator)
11156964 CNP targets the MA domain of the HIV-1 Gag protein following its association with the plasma membrane. CNP is packaged into the interior of virions and is resistant to digestion by subtilisin

AA Sequence

MNRGFSRKSHTFLPKIFFRKMSSSGAKDKPELQFPFLQDEDTVATLLECKTLFILRGLPGSGKSTLARVI      1 - 70
VDKYRDGTKMVSADAYKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLFEMADQ     71 - 140
YQYQVVLVEPKTAWRLDCAQLKEKNQWQLSADDLKKLKPGLEKDFLPLYFGWFLTKKSSETLRKAGQVFL    141 - 210
EELGNHKAFKKELRQFVPGDEPREKMDLVTYFGKRPPGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSK    211 - 280
AFTLTISALFVTPKTTGARVELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITLGCAADVEAVQTGLDLLE    281 - 350
ILRQEKGGSRGEEVGELSRGKLYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTI    351 - 420
I//

Text Mined References (66)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25930075 2015 Oligodendrocyte morphometry and expression of myelin - Related mRNA in ventral prefrontal white matter in major depressive disorder.
24808540 2014 Role of 2',3'-cyclic nucleotide 3'-phosphodiesterase in the renal 2',3'-cAMP-adenosine pathway.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24260477 2013 2',3'-cyclic nucleotide 3'-phosphodiesterases inhibit hepatitis B virus replication.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23084924 2012 Inhibition of HIV-1 particle assembly by 2',3'-cyclic-nucleotide 3'-phosphodiesterase.
23032943 2012 The association of white matter volume in psychotic disorders with genotypic variation in NRG1, MOG and CNP: a voxel-based analysis in affected individuals and their unaffected relatives.
22954668 2013 CNP and DPYSL2 mRNA expression and promoter methylation levels in brain of Alzheimer's disease patients.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
22589395 2012 Differential expression of 2',3'-cyclic-nucleotide 3'-phosphodiesterase and neural lineage markers correlate with glioblastoma xenograft infiltration and patient survival.
22473874 2012 A myelin gene causative of a catatonia-depression syndrome upon aging.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19508346 2010 Protein microarray analysis identifies cyclic nucleotide phosphodiesterase as an interactor of Nogo-A.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19348671 2009 No relationship between 2',3'-cyclic nucleotide 3'-phosphodiesterase and schizophrenia in the Chinese Han population: an expression study and meta-analysis.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19034380 2009 Alterations in oligodendrocyte proteins, calcium homeostasis and new potential markers in schizophrenia anterior temporal lobe are revealed by shotgun proteome analysis.
18676363 2008 Transketolase and 2',3'-cyclic-nucleotide 3'-phosphodiesterase type I isoforms are specifically recognized by IgG autoantibodies in multiple sclerosis patients.
18496213 2008 A family-based association study of the myelin-associated glycoprotein and 2',3'-cyclic nucleotide 3'-phosphodiesterase genes with schizophrenia.
18482256 2009 Protein microarray analysis identifies human cellular prion protein interactors.
18289148 2008 Effect of a functional single nucleotide polymorphism in the 2',3'-cyclic nucleotide 3'-phosphodiesterase gene on the expression of oligodendrocyte-related genes in schizophrenia.
17964117 2008 Expression of oligodendrocyte-associated genes in dorsolateral prefrontal cortex of patients with schizophrenia.
17306456 2007 Case-control association study of the 2',3'-cyclic nucleotide 3'-phosphodiesterase (CNP) gene and schizophrenia in the Han Chinese population.
17150526 2004 Three-dimensional structure of a cyclic-nucleotide phosphodiesterase from human brain.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
17010574 2006 The 2',3'-cyclic nucleotide 3'-phosphodiesterase and oligodendrocyte lineage transcription factor 2 genes do not appear to be associated with schizophrenia in the Japanese population.
16891421 2006 Convergent evidence that oligodendrocyte lineage transcription factor 2 (OLIG2) and interacting genes influence susceptibility to schizophrenia.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16389193 2006 Convergent evidence for 2',3'-cyclic nucleotide 3'-phosphodiesterase as a possible susceptibility gene for schizophrenia.
16343930 2006 Mitochondrial localization of CNP2 is regulated by phosphorylation of the N-terminal targeting signal by PKC: implications of a mitochondrial function for CNP2 in glial and non-glial cells.
16103231 2005 Process outgrowth in oligodendrocytes is mediated by CNP, a novel microtubule assembly myelin protein.
15713463 2005 Crystal structure of the catalytic fragment of human brain 2',3'-cyclic-nucleotide 3'-phosphodiesterase.
15502338 2004 Crystallization and preliminary X-ray crystallographic studies of human 2',3'-cyclic nucleotide 3'-phosphodiesterase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12947117 2003 Structural evidence that brain cyclic nucleotide phosphodiesterase is a member of the 2H phosphodiesterase superfamily.
12643545 Proteomic analysis of early melanosomes: identification of novel melanosomal proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12452325 2002 A single-nucleotide polymorphism in C-type natriuretic peptide gene may be associated with hypertension.
12379507 2002 Effects of endothelin-1 on release of adrenomedullin and C-type natriuretic peptide from individual human vascular endothelial cells.
11993850 2002 Leydig cells of the human testis possess astrocyte and oligodendrocyte marker molecules.
11842207 2002 2',3'-Cyclic nucleotide 3'-phosphodiesterase: a membrane-bound, microtubule-associated protein and membrane anchor for tubulin.
11156964 2001 HIV-1 Tat protein down-regulates CREB transcription factor expression in PC12 neuronal cells through a phosphatidylinositol 3-kinase/AKT/cyclic nucleoside phosphodiesterase pathway.
10646504 2000 Selective synthesis of 2',3'-cyclic nucleotide 3'-phosphodiesterase isoform 2 and identification of specifically phosphorylated serine residues.
9268698 1997 The epitope recognized by a monoclonal antibody in the myelin-associated protein CNP.
8921398 1996 Molecular cloning and chromosomal assignment of the human homologue of the rat cGMP-inhibited phosphodiesterase 1 (PDE3A)--a gene involved in fat metabolism located at 11p 15.1.
8392017 1993 Structure, expression and chromosomal localization of the gene encoding human 2',3'-cyclic-nucleotide 3'-phosphodiesterase.
7821789 1994 Construction of a human full-length cDNA bank.
6328143 1984 An investigation of 2':3'-cyclic nucleotide 3'-phosphodiesterase (EC 3.1.4.37, CNP) in peripheral blood elements and CNS myelin.
2995854 1985 Differential expression of 2':3'-cyclic nucleotide 3'-phosphodiesterase in cultured central, peripheral, and extraneural cells.
2835044 1988 cDNA cloning and amino acid sequence of human brain 2',3'-cyclic-nucleotide 3'-phosphodiesterase.
2164018 1990 2',3'-cyclic nucleotide-3'-phosphodiesterase in the central nervous system is fatty-acylated by thioester linkage.
2161933 1990 Expression of the oligodendrocyte marker 2'3'-cyclic nucleotide 3'-phosphodiesterase in non-glial cells.
1385234 1992 2',3'-cyclic nucleotide-3'-phosphohydrolase and signal transduction in central nervous system myelin.
1360194 1992 Structure and chromosomal localization of the human 2',3'-cyclic nucleotide 3'-phosphodiesterase gene.
1322358 1992 Assignment of the human 2',3'-cyclic nucleotide 3'-phosphohydrolase gene to chromosome 17.
1315529 1992 A new peptide (1150Da) selectively activates the calcium-calmodulin sensitive isoform of cyclic nucleotide phosphodiesterase from human myometrium.