Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.45
PubTator Score 4.55

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
pancreatic cancer -1.500 1.5e-02
osteosarcoma -2.294 5.4e-08
acute quadriplegic myopathy 1.133 3.3e-06
tuberculosis -1.700 1.6e-05
group 4 medulloblastoma 1.300 3.9e-03
primary Sjogren syndrome 1.200 1.2e-02
pancreatic carcinoma -1.500 1.5e-02
Breast cancer -1.200 2.1e-10
ovarian cancer -1.500 3.0e-07
pituitary cancer 1.100 6.8e-03

Protein-protein Interaction (10)

Gene RIF (7)

PMID Text
26608607 Data show that CNOT6L protein-interleukin 8 (IL-8) is a signaling axis in myogenesis.
23591815 Cnot6L, a validated target of miR-146a, affects the stability of Zeb1 mRNA.
21233283 Results identified CNOT6/CNOT6L as a key regulator of insulin-like growth factor-binding protein 5, which mediates cell cycle arrest and senescence via a p53-dependent pathway.
20818722 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628353 show that the nuclease domain of CNOT6L exhibits full Mg(2+)-dependent deadenylase activity with strict poly(A) RNA substrate specificity.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17452450 CCR4b may be involved in various cellular events that include cell proliferation.

AA Sequence

MRLIGMPKEKYDPPDPRRIYTIMSAEEVANGKKSHWAELEISGRVRSLSTSLWSLTHLTALHLNDNYLSR      1 - 70
IPPDIAKLHNLVYLDLSSNKLRSLPAELGNMVSLRELLLNNNLLRVLPYELGRLFQLQTLGLKGNPLSQD     71 - 140
ILNLYQDPDGTRKLLNFMLDNLAVHPEQLPPRPWITLKERDQILPSASFTVMCYNVLCDKYATRQLYGYC    141 - 210
PSWALNWEYRKKGIMEEIVNCDADIISLQEVETEQYFTLFLPALKERGYDGFFSPKSRAKIMSEQERKHV    211 - 280
DGCAIFFKTEKFTLVQKHTVEFNQVAMANSDGSEAMLNRVMTKDNIGVAVVLEVHKELFGAGMKPIHAAD    281 - 350
KQLLIVANAHMHWDPEYSDVKLIQTMMFVSEVKNILEKASSRPGSPTADPNSIPLVLCADLNSLPDSGVV    351 - 420
EYLSNGGVADNHKDFKELRYNECLMNFSCNGKNGSSEGRITHGFQLKSAYENNLMPYTNYTFDFKGVIDY    421 - 490
IFYSKTHMNVLGVLGPLDPQWLVENNITGCPHPHIPSDHFSLLTQLELHPPLLPLVNGVHLPNRR         491 - 555
//

Text Mined References (18)

PMID Year Title
26608607 2016 Post-transcriptional modulation of interleukin 8 by CNOT6L regulates skeletal muscle differentiation.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24057671 2014 Genome-wide association study of ancestry-specific TB risk in the South African Coloured population.
23591815 2013 Loss of Git2 induces epithelial-mesenchymal transition by miR146a-Cnot6L-controlled expression of Zeb1.
22977175 2012 The structural basis for the interaction between the CAF1 nuclease and the NOT1 scaffold of the human CCR4-NOT deadenylase complex.
21269460 2011 Initial characterization of the human central proteome.
21233283 2011 The Ccr4a (CNOT6) and Ccr4b (CNOT6L) deadenylase subunits of the human Ccr4-Not complex contribute to the prevention of cell death and senescence.
20818722 2010 A Bayesian approach to genetic association studies with family-based designs.
20628353 2010 Crystal structure of the human CNOT6L nuclease domain reveals strict poly(A) substrate specificity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19558367 2009 Human Ccr4-Not complexes contain variable deadenylase subunits.
18377426 2008 Interaction of antiproliferative protein Tob with the CCR4-NOT deadenylase complex.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17452450 2007 Depletion of mammalian CCR4b deadenylase triggers elevation of the p27Kip1 mRNA level and impairs cell growth.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.