Property Summary

NCBI Gene PubMed Count 17
PubMed Score 387.71
PubTator Score 16.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.300 1.3e-03
osteosarcoma -1.530 1.6e-06
astrocytoma 1.300 1.1e-02
atypical teratoid / rhabdoid tumor 1.200 1.8e-04
glioblastoma 1.400 3.2e-03
group 4 medulloblastoma 1.800 1.0e-03
medulloblastoma, large-cell -1.600 5.4e-05
ovarian cancer 1.900 5.0e-04
Gaucher disease type 1 -1.400 2.3e-02

Gene RIF (6)

PMID Text
25933433 CNOT4 controls the degradation of chromatin-unbound PAF1 via the 26S proteasome.
25663449 Single nucleotide polymorphism in CNOT4 gene is associated with osteosarcoma susceptibility.
22159038 Data show that Not4/CNOT4 is a novel positive regulator of the JAK/STAT pathway in Drosophila and in humans.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19558367 Data show that Ccr4-Not function in RNA splicing and nuclear export, and that CNOT4 binds CNOT1 in yeast two-hybrid assays.
15001359 Data show that binding of the CNOT4 RING finger to the ubiquitin-conjugating enzyme (E2) UbcH5B is highly selective

AA Sequence

MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPL      1 - 70
SQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHK     71 - 140
VVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDC    141 - 210
MYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQRYDTPIDKPS    211 - 280
DSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDNFRHPNPIPSG    281 - 350
LPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIE    351 - 420
KELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFS    421 - 490
FPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGEEEVKVSTMPLSTSSHS    491 - 560
LQQGQQPTSLHTTVA                                                           561 - 575
//

Text Mined References (24)

PMID Year Title
25933433 2015 Protein Degradation of RNA Polymerase II-Association Factor 1(PAF1) Is Controlled by CNOT4 and 26S Proteasome.
25663449 2015 Polymorphisms in miRNA processing genes and their role in osteosarcoma risk.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22159038 2012 Not4 enhances JAK/STAT pathway-dependent gene expression in Drosophila and in human cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19558367 2009 Human Ccr4-Not complexes contain variable deadenylase subunits.
19346402 2009 Polyubiquitination of the demethylase Jhd2 controls histone methylation and gene expression.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15001359 2004 An altered-specificity ubiquitin-conjugating enzyme/ubiquitin-protein ligase pair.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
11823428 2002 Identification of a ubiquitin-protein ligase subunit within the CCR4-NOT transcription repressor complex.
11087754 2001 The structure of the C4C4 ring finger of human NOT4 reveals features distinct from those of C3HC4 RING fingers.
10637334 2000 Isolation and characterization of human orthologs of yeast CCR4-NOT complex subunits.