Property Summary

Ligand Count 3
NCBI Gene PubMed Count 11
PubMed Score 61.20
PubTator Score 24.93

Knowledge Summary

Patent (1,725)


  Disease (5)

Disease Target Count
Congenital anosmia 1
Disease Target Count P-value
diabetes mellitus 1728 1.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
ENSP00000256078 30 0.0 0.5
Disease Target Count

Gene RIF (2)

AA Sequence

QRITVLETKMKQNNEDDYLSDGMNSPELAAADEP                                        631 - 664

Text Mined References (12)

PMID Year Title