Property Summary

NCBI Gene PubMed Count 19
PubMed Score 1646.93
PubTator Score 99.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.800 8.5e-05
astrocytic glioma -2.300 2.9e-02
Astrocytoma, Pilocytic -1.100 9.5e-04
atypical teratoid / rhabdoid tumor -1.500 9.6e-05
glioblastoma -1.500 1.0e-03
lung cancer 1.600 9.3e-03
medulloblastoma -1.100 8.9e-05
medulloblastoma, large-cell -1.600 2.6e-04
non-small cell lung cancer 1.068 1.0e-10
oligodendroglioma -1.400 1.8e-17
osteosarcoma -1.665 1.5e-04
ovarian cancer -1.300 4.0e-03
psoriasis -1.200 4.9e-03

Gene RIF (1)

AA Sequence

MDSVEKGAATSVSNPRGRPSRGRPPKLQRNSRGGQGRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVP      1 - 70
LIGWVLRAALDSGAFQSVWVSTDHDEIENVAKQFGAQVHRRSSEVSKDSSTSLDAIIEFLNYHNEVDIVG     71 - 140
NIQATSPCLHPTDLQKVAEMIREEGYDSVFSVVRRHQFRWSEIQKGVREVTEPLNLNPAKRPRRQDWDGE    141 - 210
LYENGSFYFAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDWPIAEQRVLRYGYFGKEKLKEIKLLVC    211 - 280
NIDGCLTNGHIYVSGDQKEIISYDVKDAIGISLLKKSGIEVRLISERACSKQTLSSLKLDCKMEVSVSDK    281 - 350
LAVVDEWRKEMGLCWKEVAYLGNEVSDEECLKRVGLSGAPADACSTAQKAVGYICKCNGGRGAIREFAEH    351 - 420
ICLLMEKVNNSCQK                                                            421 - 434
//

Text Mined References (23)

PMID Year Title