Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.43
PubTator Score 3.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic -1.400 6.7e-07
atypical teratoid / rhabdoid tumor -1.900 2.6e-09
ependymoma -1.200 4.0e-10
glioblastoma -1.300 1.5e-06
lung carcinoma 1.600 2.1e-19
pediatric high grade glioma -1.300 1.4e-04
primitive neuroectodermal tumor -1.100 2.5e-02

 GO Process (1)

Gene RIF (3)

AA Sequence

MGPVSLLPKYQKLNTWNGDLAKMTHLQAGLSPETIEKARLELNENPDVLHQDIQQVRDMIITRPDIGFLR      1 - 70
TDDAFILRFLRARKFHQADAFRLLAQYFQYRQLNLDMFKNFKADDPGIKRALIDGFPGVLENRDHYGRKI     71 - 140
LLLFAANWDQSRNSFTDILRAILLSLEVLIEDPELQINGFILIIDWSNFSFKQASKLTPSILKLAIEGLQ    141 - 210
DSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIHPEFLPSEFGGTLPPYDM    211 - 280
GTWARTLLGPDYSDENDYTHTSYNAMHVKHTSSNLERECSPKLMKRSQSVVEAGTLKHEEKGENENTQPL    281 - 350
LALD                                                                      351 - 354
//

Text Mined References (12)

PMID Year Title