Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.43
PubTator Score 3.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group A ependymoma -1.300 6.7e-10
glioblastoma -1.400 6.6e-04
atypical teratoid / rhabdoid tumor -1.900 2.6e-09
primitive neuroectodermal tumor -1.100 2.5e-02
pediatric high grade glioma -1.300 1.4e-04
pilocytic astrocytoma -1.400 3.9e-07
lung carcinoma 1.600 2.1e-19

 GO Process (1)

Protein-protein Interaction (1)

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19651769 Clavesin protein family appears to provide a unique neuron-specific regulation of late endosome/lysosome morphology.
18271718 CRALBPL may be used as a marker for human hepatocellular carcinomas.

AA Sequence

MGPVSLLPKYQKLNTWNGDLAKMTHLQAGLSPETIEKARLELNENPDVLHQDIQQVRDMIITRPDIGFLR      1 - 70
TDDAFILRFLRARKFHQADAFRLLAQYFQYRQLNLDMFKNFKADDPGIKRALIDGFPGVLENRDHYGRKI     71 - 140
LLLFAANWDQSRNSFTDILRAILLSLEVLIEDPELQINGFILIIDWSNFSFKQASKLTPSILKLAIEGLQ    141 - 210
DSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIHPEFLPSEFGGTLPPYDM    211 - 280
GTWARTLLGPDYSDENDYTHTSYNAMHVKHTSSNLERECSPKLMKRSQSVVEAGTLKHEEKGENENTQPL    281 - 350
LALD                                                                      351 - 354
//

Text Mined References (12)

PMID Year Title
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21116278 2011 Genome-wide association with MRI atrophy measures as a quantitative trait locus for Alzheimer's disease.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19651769 2009 The clavesin family, neuron-specific lipid- and clathrin-binding Sec14 proteins regulating lysosomal morphology.
18271718 2008 Cellular retinaldehyde-binding protein-like (CRALBPL), a novel human Sec14p-like gene that is upregulated in human hepatocellular carcinomas, may be used as a marker for human hepatocellular carcinomas.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16802092 2006 Cloning and characterization of a novel, human cellular retinaldehyde-binding protein CRALBP-like (CRALBPL) gene.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.