Property Summary

NCBI Gene PubMed Count 93
PubMed Score 422.16
PubTator Score 206.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (30)

Gene RIF (74)

PMID Text
26963514 TREM-1 and Dectin-1 function concurrently in the corneal innate immune response by regulating inflammatory cytokine expression in fungal keratitis.
26963509 study represents the first analysis demonstrating that harbouring polymorphisms of Dectin-1 (rs7309123) or TLR2 (rs5743708) represents an independent risk factor of developing IFD in patients with AML undergoing induction chemotherapy.
26352598 Our data suggest that the genetic diversity of CLEC7A gene influences the autism spectrum disorders (ASD) phenotype by behaving as a disease specifier and imply that the genetic control of innate immune response could determine the ASD phenotype.
26156997 This study demonstrated that Toll-Like Receptors and Dectin-1, a C-Type Lectin Receptor, Trigger Divergent Functions in CNS Macrophages.
26123355 this study provides novel and opposing functions of hDectin-1 expressed on the two major human DC subsets, pDCs and mDCs
25883525 The analysis of Dectin-1 gene polymorphisms showed no significant association with fungal keratitis in the northern Han Chinese population.
25461401 Data indicate that Candida albicans beta-Glucan induces high IL-1 receptor antagonist (IL-1Ra) levels, independently from Dectin-1/complement receptor 3 (CR3).
25267792 CARD9 regulates H-Ras activation by linking Ras-GRF1 to H-Ras, which mediates Dectin-1-induced extracellular signal-regulated protein kinase (ERK) activation and proinflammatory responses when stimulated by their ligands.
25251945 IECs may respond to beta-glucans by the secretion of pro-inflammatory chemokines in a Dectin-1- and Syk-dependent pathway
25161190 Dectin-1 expressed on human pulmonary epithelial cells has a considerable impact on the Nontypeable Haemophilus influenzae triggered immune response.
25008994 The result of this study suggests that there is no correlation between Dectin-1 Y238X Gene polymorphism and RVVC.
24864436 dectin-1 expression in conjunctival epithelial cells (CECs) was demonstrated, and expression of both dectin-1 and BAFF in CECs is thought to be involved in pathologic aggravation of allergic inflammatory in patients with vernal keratoconjuctivitis
24835401 Induction and activation of human Th17 by targeting antigens to dendritic cells via dectin-1.
24808366 The unconventional protein secretion triggered by the dectin-1 pathway is dependent on inflammasome activity and an active autophagic process.
24721111 this study investigated the role of dectin-1 expressed by keratinocytes in wound healing
24440830 The superoxide induction with whole glucan particle was concluded to be Dectin-1-mediated and required Src family kinases, phosphatidylinositol-3 kinase and protein kinase B/Akt.
24094722 Levels of expression of C-type lectin maybe associated with the pathogenesis of otitis media with effusion.
24068891 we found that secretory IgA is taken up by M cells via the Dectin-1 receptor, with the possible involvement of Siglec-5 acting as a co-receptor.
23787127 interaction of Dectin-1 with TLR2 seemed to require that both receptors are from the same species
23745599 Melatonin synthesis in human colostrum mononuclear cells enhances dectin-1-mediated phagocytosis by mononuclear cells.
23674515 Vimentin is an endogenous, activating ligand for Dectin-1. Its presence in areas of artery wall inflammation and O production suggests that vimentin activates Dectin-1 and contributes to lipid oxidation and cholesterol accumulation in atherosclerosis.
23475217 beta-glucan primes the response to components of human microbiota through the dectin-1 and noncanonical Raf-1 kinase pathway.
23374272 In title.
23332664 Results suggest that dectin-1 may play a role in the development of nasal polyps, and may participate in the inflammatory reaction in nasal polyps.
23239982 These data demonstrate that MBL has an ability to mediate the opsonophagocytosis of Candida albicans by human neutrophils independent of complement activation, which is coupled with intracellular Dectin-1-triggered ROS production
23097038 Expression and function of dectin-1 is defective in monocytes from patients with systemic lupus erythematosus and rheumatoid arthritis.
22952831 Antibody constant region peptides can display immunomodulatory activity through activation of the Dectin-1 signalling pathway
22674328 identified a polymorphism in the gene for Dectin-1 (CLEC7A) that is strongly linked to a severe form of ulcerative colitis
22562430 Dectin-1 contributes to the Aspergillus fumigatus-induced chemokine synthesis in human bronchial epithelial cells.
22384201 Dectin-1 and DC-SIGN polymorphisms are associated with invasive pulmonary Aspergillosis infection
22267217 dectin-1 acted as an extracellular sensor for pathogens that induced both IL-1beta production and maturation through a noncanonical caspase-8-dependent inflammasome for protective immunity
22199280 Yeast-derived beta-glucan lacks cytotoxic effects towards B-lymphoma cells but up-regulation of CD86 suggests maturation of the cells via dectin-1 by the carbohydrate
21985303 We demonstrate that heterozygosity for the Y238X DECTIN-1 polymorphism in HIV-infected patients predisposes to bacterial infections, and in particular to pneumonia.
21881131 genetic variation in DECTIN-1 was not associated with susceptibility to candidemia.
21876553 Mycobacterium abscessus activates the NLRP3 inflammasome via dectin-1/Syk-dependent signaling and the cytoplasmic scaffold protein p62/SQSTM1 in human macrophages.
21531876 results define the dectin-1/inflammasome pathway as the mechanism that enables the host immune system to mount a protective Th17 response and distinguish between colonization and tissue invasion by Candida albicans
21515468 Expressions of TLR2, TLR4 and dectin-1 increased in HaCaT cells in response to Trichophyton rubrum exposure.
21426724 TLR2 and Dectin-1 were expressed by endothelial cells in response to Aspergillus fumigatus stimulation.
21296999 Regulation of dectin-1-mediated dendritic cell activation by peroxisome proliferator-activated receptor-gamma ligand troglitazone.
21283787 Thus, dectin-1 and dectin-2 control adaptive T(H)-17 immunity to fungi via Malt1-dependent activation of c-Rel.
21242599 dectin-1 Y238X heterozygosity has a limited influence on susceptibility to invasive aspergillosis and may be important in susceptible non-hematopoietic stem cell transplantation patients; this is partly due to redundancy inherent in innate immune system
20807886 role for Dectin-1 in antifungal immunity that is the ability to control both resistance and tolerance to the fungus contingent on hematopoietic/nonhematopoietic compartmentalization
20807886 Observational study of gene-disease association. (HuGE Navigator)
20700596 Dectin-1, a pattern recognition receptor involved in antifungal immunity, polymorphisms in the gene may play a role in human disease (Review)
20631729 A remarkably high expression of dectin-1 mRNA was observed in psoriatic epidermis
20608913 Mast cells from atopic eczema patients have impaired upregulation of the fungal recognition receptor Dectin-1.
20577092 Observational study of gene-disease association. (HuGE Navigator)
20452827 The effects of the dectin-1 Y238X polymorphism on graft-versus-host disease and Candida sp. colonization in stem cell transplantation patients are reported.
20452827 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20421639 beta-glucans are recognized by membrane-associated dectin-1 and cytoplasmic NLRP3 inflammasome
20360401 distinct roles of CR3, Dectin-1, and sialic acids in the interaction with Histoplasma and suggested that multiple receptor use might be important to host defense against Histoplasma.
20299682 the MTB-induced IL-17A response relies strongly on the endogenous IL-1 pathway and IL-1R signaling. TLR4 and dectin-1 are the main receptors responsible for mediating the signals responsible for IL-17A production by MTB.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20158887 loss of one functional allele of DECTIN-1 is not associated with either susceptibility to or severity of rheumatoid arthritis
19915667 dectin-1 expression is elevated on macrophages, neutrophils, and other immune cells involved in the inflammatory reaction in inflammatory bowel disease (IBD), but is not the major susceptibility factor for IBD.
19915667 Observational study of gene-disease association. (HuGE Navigator)
19888805 Results demonstrate a decrease of TLRs and dectin-1 expression mainly on monocytes as opposed to neutrophils, as soon as 30 minutes after Paracoccidioides brasiliensis stimulation.
19864674 mutated form of dectin-1 was poorly expressed, did not mediate beta-glucan binding, and led to defective production of cytokines...higlights specific role of dectin-1 in human mucosal antifungal defense
19811837 Dectin-1, although indispensable for recognition of beta-glucan-bearing particles in mice, is not the major receptor for yeast particles in human neutrophils.
19773555 Dectin-1 engagement by Mtb enables DC to promote a Th1/Th17 response, whereas DC-SIGN and MR costimulation limits dectin-1-dependent Th17 generation and favors a Th1 response, probably by interfering with release of cytokines.
19633936 demonstrate the novel induction of Dectin-1 in type II airway epithelial cells and its critical role in the innate immune response against Mtb in non-phagocytic cells
19614557 This study suggests a crucial role played by dectin-1 in the mucosal antifungal mechanisms in immunocompromised hosts.
19614557 Observational study of gene-disease association. (HuGE Navigator)
19358895 Collectively, these findings identify Dectin-1 as a key receptor influencing critical biological functions of DC in response to C. albicans leading to T cells response alteration.
19223162 co-stimulation of dendritic cell-specific ICAM-3 receptor and Dectin-1 induces the metabolism of arachidonic acid
19134118 Our results demonstrate that TLR2, TLR4 and Dectin-1 actively sense, internalize and respond in an innate way to Mycobacterium ulcerans in human epidermal keratinocytes.
19122653 dectin-1 activates two independent signaling pathways, one through Syk and one through Raf-1, to induce immune responses.
18549457 dectin-1 synergizes with both TLR2 and TLR4 pathways for the production of TNF-alpha in human primary PBMCs and in monocyte-derived macrophages.
17698636 hDectin-1 is involved in the uptake and cross-presentation of cellular antigens.
17182550 CD37 is important for dectin-1 stabilization in APC membranes and controls dectin-1-mediated IL-6 production.
16870151 hDectin-1E was not secreted and it mainly resided in the cytoplasm. The binding of hDectin-1E and RanBPM was further confirmed in vivo by co-immunoprecipitation assay and confocal microscopic analysis.
15956283 Dectin-1 activates Syk tyrosine kinase in macrophages for reactive oxygen production
14707091 Uptake of zymosan particles can occur by beta glucan receptor (or SIGNR1) and results in TNF-alpha production by macrophages.
12423684 Dectin-1b cDNA encodes for a transmembrane protein of the C-type lectin-like receptor family. It is selectively expressed in several purified DC subpopulations but not in monocytes and is up-regulated upon stimulation with lipopolysaccharide.

AA Sequence

MEYHPDLENLDEDGYTQLHFDSQSNTRIAVVSEKGSCAASPPWRLIAVILGILCLVILVIAVVLGTMAIW      1 - 70
RSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNS     71 - 140
WDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTT    141 - 210
ATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM                                     211 - 247
//

Text Mined References (96)

PMID Year Title
26963514 2016 Inhibition of TREM-1 and Dectin-1 Alleviates the Severity of Fungal Keratitis by Modulating Innate Immune Responses.
26963509 2016 Polymorphisms of Dectin-1 and TLR2 Predispose to Invasive Fungal Disease in Patients with Acute Myeloid Leukemia.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26352598 2015 Dectin-1 Polymorphism: A Genetic Disease Specifier in Autism Spectrum Disorders?
26156997 2015 Toll-Like Receptors and Dectin-1, a C-Type Lectin Receptor, Trigger Divergent Functions in CNS Macrophages.
26123355 2015 Opposing Roles of Dectin-1 Expressed on Human Plasmacytoid Dendritic Cells and Myeloid Dendritic Cells in Th2 Polarization.
25883525 2015 Association of Dectin-1 and DC-SIGN gene single nucleotide polymorphisms with fungal keratitis in the northern Han Chinese population.
25461401 2015 An anti-inflammatory property of Candida albicans ?-glucan: Induction of high levels of interleukin-1 receptor antagonist via a Dectin-1/CR3 independent mechanism.
25416956 2014 A proteome-scale map of the human interactome network.
25267792 2014 CARD9 mediates Dectin-1-induced ERK activation by linking Ras-GRF1 to H-Ras for antifungal immunity.
25251945 2014 Human intestinal epithelial cells respond to ?-glucans via Dectin-1 and Syk.
25161190 2014 Dectin-1 is expressed in human lung and mediates the proinflammatory immune response to nontypeable Haemophilus influenzae.
25008994 2014 The role of Human Dectin-1 Y238X Gene Polymorphism in recurrent vulvovaginal candidiasis infections.
24864436 2014 [Evaluation of dectin-1 and BAFF expression in conjunctival epithelial cells].
24835401 2014 Induction and activation of human Th17 by targeting antigens to dendritic cells via dectin-1.
24808366 2014 Dectin-1 pathway activates robust autophagy-dependent unconventional protein secretion in human macrophages.
24721111 Dectin-1 activation induces proliferation and migration of human keratinocytes enhancing wound re-epithelialization.
24440830 2014 Differential regulation of oxidative burst by distinct ?-glucan-binding receptors and signaling pathways in human peripheral blood mononuclear cells.
24094722 2013 C-type lectin receptors mRNA expression in patients with otitis media with effusion.
24068891 2013 Dectin-1 is essential for reverse transcytosis of glycosylated SIgA-antigen complexes by intestinal M cells.
23787127 2013 Species-specific PAMP recognition by TLR2 and evidence for species-restricted interaction with Dectin-1.
23745599 2013 Melatonin synthesis in human colostrum mononuclear cells enhances dectin-1-mediated phagocytosis by mononuclear cells.
23674515 2013 Vimentin is an endogenous ligand for the pattern recognition receptor Dectin-1.
23475217 2013 Candida albicans primes TLR cytokine responses through a Dectin-1/Raf-1-mediated pathway.
23374272 2013 Combined DOCK8 and CLEC7A mutations causing immunodeficiency in 3 brothers with diarrhea, eczema, and infections.
23332664 Increased expression of dectin-1 in nasal polyps.
23239982 2012 MBL-mediated opsonophagocytosis of Candida albicans by human neutrophils is coupled with intracellular Dectin-1-triggered ROS production.
23097038 2013 Expression and function of dectin-1 is defective in monocytes from patients with systemic lupus erythematosus and rheumatoid arthritis.
22952831 2012 Antibody constant region peptides can display immunomodulatory activity through activation of the Dectin-1 signalling pathway.
22674328 2012 Interactions between commensal fungi and the C-type lectin receptor Dectin-1 influence colitis.
22562430 2012 Dectin-1 is inducible and plays a crucial role in Aspergillus-induced innate immune responses in human bronchial epithelial cells.
22384201 2012 Dectin-1 and DC-SIGN polymorphisms associated with invasive pulmonary Aspergillosis infection.
22267217 2012 Dectin-1 is an extracellular pathogen sensor for the induction and processing of IL-1? via a noncanonical caspase-8 inflammasome.
22199280 2011 Yeast-derived beta-(1-3),(1-6)-D-glucan induces up-regulation of CD86 on dectin-1-positive human B-lymphoma cell lines.
21985303 2011 Variation in genes of ?-glucan recognition pathway and susceptibility to opportunistic infections in HIV-positive patients.
21881131 2011 Genetic variation in the dectin-1/CARD9 recognition pathway and susceptibility to candidemia.
21876553 2012 Mycobacterium abscessus activates the NLRP3 inflammasome via Dectin-1-Syk and p62/SQSTM1.
21531876 2011 The dectin-1/inflammasome pathway is responsible for the induction of protective T-helper 17 responses that discriminate between yeasts and hyphae of Candida albicans.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21515468 2011 [The immune response of human keratinocytes to Trichophyton rubrum conidia is partially mediated by toll-like receptor-2, 4, dectin-1 and cytokines].
21426724 2011 [The changes of Dectin-1 and TLR2 in human umbilical vein endothelial cells stimulated by Aspergillus fumigatus].
21296999 2011 Regulation of dectin-1-mediated dendritic cell activation by peroxisome proliferator-activated receptor-gamma ligand troglitazone.
21283787 2011 Selective C-Rel activation via Malt1 controls anti-fungal T(H)-17 immunity by dectin-1 and dectin-2.
21242599 2011 The Y238X stop codon polymorphism in the human ?-glucan receptor dectin-1 and susceptibility to invasive aspergillosis.
20807886 2010 Dectin-1 Y238X polymorphism associates with susceptibility to invasive aspergillosis in hematopoietic transplantation through impairment of both recipient- and donor-dependent mechanisms of antifungal immunity.
20700596 2011 Dectin-1: a role in antifungal defense and consequences of genetic polymorphisms in humans.
20631729 2010 A comprehensive analysis of pattern recognition receptors in normal and inflamed human epidermis: upregulation of dectin-1 in psoriasis.
20608913 2011 Mast cells generated from patients with atopic eczema have enhanced levels of granule mediators and an impaired Dectin-1 expression.
20577092 2010 Genetic variation of innate immune genes in HIV-infected african patients with or without oropharyngeal candidiasis.
20452827 2010 The incidence of acute graft-versus-host disease increases with Candida colonization depending the dectin-1 gene status.
20421639 2010 (1,3)-beta-glucans activate both dectin-1 and NLRP3 inflammasome in human macrophages.
20360401 2010 Distinct roles of complement receptor 3, Dectin-1, and sialic acids in murine macrophage interaction with Histoplasma yeast.
20299682 2010 Mycobacterium tuberculosis induces IL-17A responses through TLR4 and dectin-1 and is critically dependent on endogenous IL-1.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20158887 2010 Functional consequences of DECTIN-1 early stop codon polymorphism Y238X in rheumatoid arthritis.
19915667 2009 Genetic association analysis of the functional c.714T>G polymorphism and mucosal expression of dectin-1 in inflammatory bowel disease.
19888805 2009 TLR-2, TLR-4 and dectin-1 expression in human monocytes and neutrophils stimulated by Paracoccidioides brasiliensis.
19864674 2009 Human dectin-1 deficiency and mucocutaneous fungal infections.
19811837 2009 Complement receptor 3, not Dectin-1, is the major receptor on human neutrophils for beta-glucan-bearing particles.
19773555 2009 Induction of Th1/Th17 immune response by Mycobacterium tuberculosis: role of dectin-1, Mannose Receptor, and DC-SIGN.
19633936 2009 Dectin-1 is inducible and plays an essential role for mycobacteria-induced innate immune responses in airway epithelial cells.
19614557 2009 Early stop polymorphism in human DECTIN-1 is associated with increased candida colonization in hematopoietic stem cell transplant recipients.
19358895 Dectin-1 is required for human dendritic cells to initiate immune response to Candida albicans through Syk activation.
19223162 2009 Pattern recognition: recent insights from Dectin-1.
19134118 2009 Innate immune responses to Mycobacterium ulcerans via toll-like receptors and dectin-1 in human keratinocytes.
19122653 2009 Dectin-1 directs T helper cell differentiation by controlling noncanonical NF-kappaB activation through Raf-1 and Syk.
18549457 2008 Dectin-1 synergizes with TLR2 and TLR4 for cytokine production in human primary monocytes and macrophages.
17698636 2008 hDectin-1 is involved in uptake and cross-presentation of cellular antigens.
17230442 2007 Dectin-1 promotes fungicidal activity of human neutrophils.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17182550 2007 Dectin-1 interaction with tetraspanin CD37 inhibits IL-6 production.
16870151 2006 Human Dectin-1 isoform E is a cytoplasmic protein and interacts with RanBPM.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341139 2006 Dectin-1: a signalling non-TLR pattern-recognition receptor.
15956283 2005 Dectin-1 activates Syk tyrosine kinase in a dynamic subset of macrophages for reactive oxygen production.
15944324 2005 Mannose-containing molecular patterns are strong inducers of cyclooxygenase-2 expression and prostaglandin E2 production in human macrophages.
15816015 2005 The human beta-glucan receptor is widely expressed and functionally equivalent to murine Dectin-1 on primary cells.
15728245 2005 Regulated recruitment of DC-SIGN to cell-cell contact regions during zymosan-induced human dendritic cell aggregation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15130945 2004 CD63 tetraspanin slows down cell migration and translocates to the endosomal-lysosomal-MIICs route after extracellular stimuli in human immature dendritic cells.
14707091 2004 The role of SIGNR1 and the beta-glucan receptor (dectin-1) in the nonopsonic recognition of yeast by specific macrophages.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12945048 2003 Evolutionary analysis reveals collective properties and specificity in the C-type lectin and lectin-like domain superfamily.
12689921 2003 Nontypeable Haemophilus influenzae activates human eosinophils through beta-glucan receptors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12423684 2002 Molecular and functional characterization of human Dectin-1.
11745369 2001 A novel cluster of lectin-like receptor genes expressed in monocytic, dendritic and endothelial cells maps close to the NK receptor genes in the human NK gene complex.
11567029 2001 Characterization of the human beta -glucan receptor and its alternatively spliced isoforms.
11544516 2001 Immune recognition. A new receptor for beta-glucans.
11491532 Cloning of human DECTIN-1, a novel C-type lectin-like receptor gene expressed on dendritic cells.
11470510 2001 Identification of a human homologue of the dendritic cell-associated C-type lectin-1, dectin-1.
10779524 2000 Identification of a novel, dendritic cell-associated molecule, dectin-1, by subtractive cDNA cloning.
10508765 1999 C-type lectin-like domains.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.